BLASTX nr result
ID: Atractylodes22_contig00031442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031442 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525905.1| PREDICTED: uncharacterized protein LOC100792... 56 3e-06 ref|XP_003522914.1| PREDICTED: uncharacterized protein LOC100792... 55 5e-06 ref|XP_002271414.2| PREDICTED: putative lipase ROG1-like [Vitis ... 55 6e-06 >ref|XP_003525905.1| PREDICTED: uncharacterized protein LOC100792195 [Glycine max] Length = 445 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -3 Query: 335 QRYLAHNTIQVNTPWMNSDGADVIQHIVDHFLV 237 QRY+AH+TIQV T W+NSDGADV+ H++D+FL+ Sbjct: 413 QRYIAHSTIQVKTYWLNSDGADVVYHMIDNFLL 445 >ref|XP_003522914.1| PREDICTED: uncharacterized protein LOC100792868 [Glycine max] Length = 419 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -3 Query: 335 QRYLAHNTIQVNTPWMNSDGADVIQHIVDHFLV 237 QRY+AH+TIQV T W+NSDGADV+ H++D+FL+ Sbjct: 387 QRYVAHSTIQVKTYWLNSDGADVVYHMIDNFLL 419 >ref|XP_002271414.2| PREDICTED: putative lipase ROG1-like [Vitis vinifera] Length = 422 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -3 Query: 335 QRYLAHNTIQVNTPWMNSDGADVIQHIVDHFLV 237 QRY+AHNTIQV + W+NSDGADV+ H++D+FL+ Sbjct: 390 QRYVAHNTIQVKSYWLNSDGADVVFHMIDNFLL 422