BLASTX nr result
ID: Atractylodes22_contig00031425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031425 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514142.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 gb|AFK45233.1| unknown [Lotus japonicus] 57 1e-06 emb|CBI27926.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002282397.1| PREDICTED: uncharacterized protein LOC100262... 57 1e-06 ref|XP_003630634.1| hypothetical protein MTR_8g101600 [Medicago ... 57 2e-06 >ref|XP_002514142.1| conserved hypothetical protein [Ricinus communis] gi|223546598|gb|EEF48096.1| conserved hypothetical protein [Ricinus communis] Length = 315 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/49 (55%), Positives = 31/49 (63%) Frame = +3 Query: 3 CYNCDSCKAGVLGNLRKEWRRXXXXXXXXXXXXXXXYFIAFNAYKNAHT 149 CYNCDSCKAG+LGNLRKEWR+ Y IA +A+KNA T Sbjct: 255 CYNCDSCKAGLLGNLRKEWRKANVIIIVAVVVLIWVYLIACSAFKNAQT 303 >gb|AFK45233.1| unknown [Lotus japonicus] Length = 269 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = +3 Query: 3 CYNCDSCKAGVLGNLRKEWRRXXXXXXXXXXXXXXXYFIAFNAYKNAHT 149 CYNC++CKAG+LGNLRKEWR+ Y IA +A+KNA T Sbjct: 209 CYNCNTCKAGLLGNLRKEWRKANIILIVAVVVLICVYIIACSAFKNAQT 257 >emb|CBI27926.3| unnamed protein product [Vitis vinifera] Length = 111 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/49 (53%), Positives = 30/49 (61%) Frame = +3 Query: 3 CYNCDSCKAGVLGNLRKEWRRXXXXXXXXXXXXXXXYFIAFNAYKNAHT 149 CY C+SCKAG+LGNLRKEWRR Y IA +A+KNA T Sbjct: 51 CYGCNSCKAGLLGNLRKEWRRANVILIVAVVVLIWVYLIACSAFKNAQT 99 >ref|XP_002282397.1| PREDICTED: uncharacterized protein LOC100262870 [Vitis vinifera] Length = 269 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/49 (53%), Positives = 30/49 (61%) Frame = +3 Query: 3 CYNCDSCKAGVLGNLRKEWRRXXXXXXXXXXXXXXXYFIAFNAYKNAHT 149 CY C+SCKAG+LGNLRKEWRR Y IA +A+KNA T Sbjct: 209 CYGCNSCKAGLLGNLRKEWRRANVILIVAVVVLIWVYLIACSAFKNAQT 257 >ref|XP_003630634.1| hypothetical protein MTR_8g101600 [Medicago truncatula] gi|355524656|gb|AET05110.1| hypothetical protein MTR_8g101600 [Medicago truncatula] Length = 269 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = +3 Query: 3 CYNCDSCKAGVLGNLRKEWRRXXXXXXXXXXXXXXXYFIAFNAYKNAHT 149 CYNC++CKAG+LGNLRKEWR+ Y IA +A+KNA T Sbjct: 209 CYNCNACKAGLLGNLRKEWRKANIILIVAVVVLIWVYVIACSAFKNAQT 257