BLASTX nr result
ID: Atractylodes22_contig00031247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031247 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530481.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002530481.1| conserved hypothetical protein [Ricinus communis] gi|223529978|gb|EEF31904.1| conserved hypothetical protein [Ricinus communis] Length = 365 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 450 CDFFNYTGNVVCRKCNCERPKDAEATYKEQMWRRP 346 CDF N++ N VCRKC CERPK A Y+EQ+WRRP Sbjct: 330 CDFLNFSRNAVCRKCKCERPKGATTEYEEQIWRRP 364