BLASTX nr result
ID: Atractylodes22_contig00031161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031161 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_16599981.1| hypothetical protein HMPREF9565_01483 [Propio... 141 5e-32 ref|ZP_04645459.1| pG1 protein [Lactobacillus jensenii 269-3] gi... 110 9e-23 emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gr... 89 3e-16 ref|ZP_05839395.1| conserved hypothetical protein [Brucella suis... 86 2e-15 gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33] gi|1... 60 7e-15 >ref|ZP_16599981.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] gi|315078257|gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] Length = 113 Score = 141 bits (356), Expect = 5e-32 Identities = 65/70 (92%), Positives = 67/70 (95%) Frame = +1 Query: 82 LRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLPTRSTTYEPFTPNNSGQRSRPTYYRG 261 +RIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLPTRSTTYEPFTPN SGQRS PTY+RG Sbjct: 1 MRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLPTRSTTYEPFTPNKSGQRSHPTYHRG 60 Query: 262 CWHVVSRRFF 291 CWHVVSR FF Sbjct: 61 CWHVVSRCFF 70 >ref|ZP_04645459.1| pG1 protein [Lactobacillus jensenii 269-3] gi|238832245|gb|EEQ24559.1| pG1 protein [Lactobacillus jensenii 269-3] Length = 174 Score = 110 bits (276), Expect = 9e-23 Identities = 57/91 (62%), Positives = 62/91 (68%) Frame = +1 Query: 16 LSLLSVRKGPENRLRHWCSS*YLRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLPTRS 195 LS LSV PE+RLRHWCSS YLRIPPLH EF SPL S VS A LS +++ T Sbjct: 2 LSSLSVSYRPESRLRHWCSSIYLRIPPLHMEFRSPLLHSRLTVSDAVLRLSRRLSHQTYQ 61 Query: 196 TTYEPFTPNNSGQRSRPTYYRGCWHVVSRRF 288 + FTPN SGQR PTYYRGCWHVVSR F Sbjct: 62 SACARFTPNKSGQRLPPTYYRGCWHVVSRDF 92 >emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gryphiswaldense MSR-1] Length = 78 Score = 89.4 bits (220), Expect = 3e-16 Identities = 47/77 (61%), Positives = 53/77 (68%) Frame = +1 Query: 7 LPTLSLLSVRKGPENRLRHWCSS*YLRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLP 186 LPTLS +SV + P +RLRHWCSS YLRI PLH EFH PL SS VSKA LSP ++L Sbjct: 2 LPTLSHMSVNRRPGSRLRHWCSSEYLRISPLHSEFHYPLRDSSSTVSKAVPRLSPGLSLL 61 Query: 187 TRSTTYEPFTPNNSGQR 237 T T FTP+NS QR Sbjct: 62 TDRTACVRFTPSNSEQR 78 >ref|ZP_05839395.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261219753|ref|ZP_05934034.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261313973|ref|ZP_05953170.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261316150|ref|ZP_05955347.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|260154114|gb|EEW89197.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260924842|gb|EEX91410.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295373|gb|EEX98869.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261302999|gb|EEY06496.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 62 Score = 86.3 bits (212), Expect = 2e-15 Identities = 43/58 (74%), Positives = 45/58 (77%) Frame = +1 Query: 7 LPTLSLLSVRKGPENRLRHWCSS*YLRIPPLHQEFHSPLPSSSQPVSKARSGLSPKIT 180 LPTLS LSV GP +RLRHWCSS YLRI PLH EFHSPLP S PVSKA GLSP I+ Sbjct: 2 LPTLSHLSVSNGPVSRLRHWCSSEYLRISPLHSEFHSPLPYSRLPVSKAVPGLSPGIS 59 >gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33] gi|145690754|gb|ABP91259.1| unknown protein [Streptococcus suis 98HAH33] gi|145690985|gb|ABP91490.1| unknown protein [Streptococcus suis 98HAH33] gi|145691080|gb|ABP91585.1| unknown protein [Streptococcus suis 98HAH33] Length = 186 Score = 60.5 bits (145), Expect(2) = 7e-15 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +1 Query: 163 LSPKITLPTRSTTYEPFTPNNSGQRSRPTYYRGCWHVVSRRF 288 LS + L T T FTPN SGQRS PTYYRGCWHVVSR F Sbjct: 94 LSHSLLLQTYQTACARFTPNKSGQRSGPTYYRGCWHVVSRPF 135 Score = 44.7 bits (104), Expect(2) = 7e-15 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = +3 Query: 3 FAPHAFAXXXXXXXXXXXSPLVFLLISAHSTAPPGIPFSPTFLKSTRIESTL 158 FAPHAF SP VFL IS H TA GIP SP+ LK +S L Sbjct: 41 FAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSALKFDSFQSVL 92