BLASTX nr result
ID: Atractylodes22_contig00031131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031131 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192153.1| phytochrome A-associated F-box protein [Arabido... 61 8e-08 ref|XP_002523077.1| Phytochrome A-associated F-box protein, puta... 60 2e-07 ref|XP_002302709.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 gb|AAM62754.1| unknown [Arabidopsis thaliana] 59 4e-07 ref|XP_003521567.1| PREDICTED: phytochrome A-associated F-box pr... 59 4e-07 >ref|NP_192153.1| phytochrome A-associated F-box protein [Arabidopsis thaliana] gi|68052208|sp|Q8LEA8.2|EID1_ARATH RecName: Full=Phytochrome A-associated F-box protein; AltName: Full=Empfindlicher im dunkelroten Licht protein 1 gi|3193286|gb|AAC19270.1| T14P8.22 [Arabidopsis thaliana] gi|7269004|emb|CAB80737.1| putative protein [Arabidopsis thaliana] gi|25083158|gb|AAN72049.1| putative protein [Arabidopsis thaliana] gi|30984562|gb|AAP42744.1| At4g02440 [Arabidopsis thaliana] gi|110739507|dbj|BAF01662.1| EID1 [Arabidopsis thaliana] gi|332656772|gb|AEE82172.1| phytochrome A-associated F-box protein [Arabidopsis thaliana] Length = 336 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 160 AEHVFSYLSDDVVLNIFFKLVDDPRNWSSLACVCTK 267 AE VFS + +DVV NIFFKL DDPRNW+ LACVCTK Sbjct: 2 AESVFSCIPEDVVFNIFFKLQDDPRNWARLACVCTK 37 >ref|XP_002523077.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] gi|223537639|gb|EEF39262.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] Length = 332 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 169 VFSYLSDDVVLNIFFKLVDDPRNWSSLACVCTK 267 +FS L+DD+VL IFFKL DDPRNW+ LACVCTK Sbjct: 6 IFSKLADDIVLTIFFKLEDDPRNWARLACVCTK 38 >ref|XP_002302709.1| predicted protein [Populus trichocarpa] gi|222844435|gb|EEE81982.1| predicted protein [Populus trichocarpa] Length = 331 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 145 MSETEAEHVFSYLSDDVVLNIFFKLVDDPRNWSSLACVCTK 267 M+ET FS LSDDVVLNIF KL DDPRNW+ LACVCTK Sbjct: 1 MTETTG---FSKLSDDVVLNIFSKLEDDPRNWARLACVCTK 38 >gb|AAM62754.1| unknown [Arabidopsis thaliana] Length = 337 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 160 AEHVFSYLSDDVVLNIFFKLVDDPRNWSSLACVCTK 267 AE VFS + +DVV IFFKL DDPRNW+ LACVCTK Sbjct: 2 AESVFSCIPEDVVFKIFFKLQDDPRNWARLACVCTK 37 >ref|XP_003521567.1| PREDICTED: phytochrome A-associated F-box protein-like [Glycine max] Length = 327 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 163 EHVFSYLSDDVVLNIFFKLVDDPRNWSSLACVCTK 267 +++FS L+DD+VLNIF+KL DDPR+W+ LACVCTK Sbjct: 9 KNLFSELTDDIVLNIFYKLEDDPRHWARLACVCTK 43