BLASTX nr result
ID: Atractylodes22_contig00031062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031062 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318955.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002512503.1| ribosomal pseudouridine synthase, putative [... 57 2e-06 ref|XP_002894642.1| pseudouridine synthase family protein [Arabi... 54 1e-05 >ref|XP_002318955.1| predicted protein [Populus trichocarpa] gi|222857331|gb|EEE94878.1| predicted protein [Populus trichocarpa] Length = 261 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 310 HELHAESLSFEHPVTGSPIVIRAPLPLWASK*WHH 206 HELHAESLS EHPVTG P++ RAPLP+WA++ + H Sbjct: 223 HELHAESLSLEHPVTGQPLMFRAPLPVWATRWFSH 257 >ref|XP_002512503.1| ribosomal pseudouridine synthase, putative [Ricinus communis] gi|223548464|gb|EEF49955.1| ribosomal pseudouridine synthase, putative [Ricinus communis] Length = 321 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -1 Query: 310 HELHAESLSFEHPVTGSPIVIRAPLPLWA 224 HELHAE+LSFEHPVTG P+++RAPLP WA Sbjct: 286 HELHAETLSFEHPVTGVPVMLRAPLPSWA 314 >ref|XP_002894642.1| pseudouridine synthase family protein [Arabidopsis lyrata subsp. lyrata] gi|297340484|gb|EFH70901.1| pseudouridine synthase family protein [Arabidopsis lyrata subsp. lyrata] Length = 321 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 310 HELHAESLSFEHPVTGSPIVIRAPLPLWASK 218 HELHAE LS +HPVT PIVIRAPLP WA++ Sbjct: 285 HELHAECLSLDHPVTDDPIVIRAPLPCWATR 315