BLASTX nr result
ID: Atractylodes22_contig00030990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030990 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81217.1| hypothetical protein VITISV_020309 [Vitis vinifera] 55 8e-06 >emb|CAN81217.1| hypothetical protein VITISV_020309 [Vitis vinifera] Length = 984 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 140 EAVHTAQPNELGNIQAAYQLNGRKSRNYMIWSQVVHTKLKGKGKL 6 E V + QP EL NIQAAY+L+G+ NY+ WSQ+V T LKGKGK+ Sbjct: 15 EIVRSQQPGELQNIQAAYRLDGK---NYLKWSQLVRTVLKGKGKI 56