BLASTX nr result
ID: Atractylodes22_contig00030941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030941 (630 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA64318.1| TPA: anther-specific proline-rich protein APG [Z... 75 1e-11 tpg|DAA64317.1| TPA: hypothetical protein ZEAMMB73_242688 [Zea m... 75 1e-11 gb|ACR34471.1| unknown [Zea mays] 75 1e-11 gb|ACG32957.1| anther-specific proline-rich protein APG precurso... 75 1e-11 ref|NP_001241717.1| uncharacterized protein LOC100856895 precurs... 75 1e-11 >tpg|DAA64318.1| TPA: anther-specific proline-rich protein APG [Zea mays] Length = 404 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -1 Query: 264 EVTDKGCCGTGDIELSFLCNKLS-PTCHDDSKFLFWDSIHLSENGCNIFVNHILPDLVNS 88 EV+ +GCCGTGD+E+S LCN+L+ PTC DD K++FWDS H +E I V+++ P + + Sbjct: 343 EVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIEN 402 Query: 87 L 85 L Sbjct: 403 L 403 >tpg|DAA64317.1| TPA: hypothetical protein ZEAMMB73_242688 [Zea mays] Length = 410 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -1 Query: 264 EVTDKGCCGTGDIELSFLCNKLS-PTCHDDSKFLFWDSIHLSENGCNIFVNHILPDLVNS 88 EV+ +GCCGTGD+E+S LCN+L+ PTC DD K++FWDS H +E I V+++ P + + Sbjct: 349 EVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIEN 408 Query: 87 L 85 L Sbjct: 409 L 409 >gb|ACR34471.1| unknown [Zea mays] Length = 353 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -1 Query: 264 EVTDKGCCGTGDIELSFLCNKLS-PTCHDDSKFLFWDSIHLSENGCNIFVNHILPDLVNS 88 EV+ +GCCGTGD+E+S LCN+L+ PTC DD K++FWDS H +E I V+++ P + + Sbjct: 292 EVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIEN 351 Query: 87 L 85 L Sbjct: 352 L 352 >gb|ACG32957.1| anther-specific proline-rich protein APG precursor [Zea mays] Length = 353 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -1 Query: 264 EVTDKGCCGTGDIELSFLCNKLS-PTCHDDSKFLFWDSIHLSENGCNIFVNHILPDLVNS 88 EV+ +GCCGTGD+E+S LCN+L+ PTC DD K++FWDS H +E I V+++ P + + Sbjct: 292 EVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIEN 351 Query: 87 L 85 L Sbjct: 352 L 352 >ref|NP_001241717.1| uncharacterized protein LOC100856895 precursor [Zea mays] gi|194708338|gb|ACF88253.1| unknown [Zea mays] Length = 359 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -1 Query: 264 EVTDKGCCGTGDIELSFLCNKLS-PTCHDDSKFLFWDSIHLSENGCNIFVNHILPDLVNS 88 EV+ +GCCGTGD+E+S LCN+L+ PTC DD K++FWDS H +E I V+++ P + + Sbjct: 298 EVSTRGCCGTGDLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIEN 357 Query: 87 L 85 L Sbjct: 358 L 358