BLASTX nr result
ID: Atractylodes22_contig00030816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030816 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM89395.1| glutamate/malate translocator [Flaveria bidentis] 156 1e-36 gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum] 148 4e-34 ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thalia... 147 7e-34 ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata... 147 1e-33 dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila] 146 2e-33 >gb|AAM89395.1| glutamate/malate translocator [Flaveria bidentis] Length = 563 Score = 156 bits (395), Expect = 1e-36 Identities = 74/85 (87%), Positives = 83/85 (97%) Frame = +2 Query: 2 LSLSAGSKPNDPSAKKLGSYLIQSQFQCSGNSSGLYLTAAAQNLLCLKLAEELGVVIADP 181 LSLSAGSKPNDPS++KLGSYLIQ+QFQC+GNSS L+LTAAAQNLLCLKLAEELG+VIA P Sbjct: 245 LSLSAGSKPNDPSSRKLGSYLIQTQFQCAGNSSALFLTAAAQNLLCLKLAEELGLVIASP 304 Query: 182 WITWFKAASLPAFVSLLLTPYILYK 256 W++WFKAASLPAF+SLLLTPYILYK Sbjct: 305 WVSWFKAASLPAFISLLLTPYILYK 329 >gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum] Length = 583 Score = 148 bits (374), Expect = 4e-34 Identities = 71/85 (83%), Positives = 81/85 (95%) Frame = +2 Query: 2 LSLSAGSKPNDPSAKKLGSYLIQSQFQCSGNSSGLYLTAAAQNLLCLKLAEELGVVIADP 181 LSLSAGSKP DPS++KLGSYLIQSQFQ +GNSS L+LTAAAQNLLCLKLAEELGVVI++P Sbjct: 265 LSLSAGSKPGDPSSRKLGSYLIQSQFQSAGNSSALFLTAAAQNLLCLKLAEELGVVISNP 324 Query: 182 WITWFKAASLPAFVSLLLTPYILYK 256 W++WFKAASLPAF+SLL TP+ILYK Sbjct: 325 WVSWFKAASLPAFISLLATPFILYK 349 >ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thaliana] gi|75171656|sp|Q9FMF7.1|DIT21_ARATH RecName: Full=Dicarboxylate transporter 2.1, chloroplastic; AltName: Full=AtpDCT1; AltName: Full=Glutamate/malate translocator; Flags: Precursor gi|9759405|dbj|BAB09860.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana] gi|15810581|gb|AAL07178.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis thaliana] gi|23397031|gb|AAN31801.1| putative 2-oxoglutarate/malate translocator [Arabidopsis thaliana] gi|53850569|gb|AAU95461.1| At5g64290 [Arabidopsis thaliana] gi|332010483|gb|AED97866.1| dicarboxylate transport 2.1 [Arabidopsis thaliana] Length = 563 Score = 147 bits (372), Expect = 7e-34 Identities = 71/85 (83%), Positives = 80/85 (94%) Frame = +2 Query: 2 LSLSAGSKPNDPSAKKLGSYLIQSQFQCSGNSSGLYLTAAAQNLLCLKLAEELGVVIADP 181 LSLSAGSKPND S++KLGSYLIQSQFQC+GNSS L+LTAAAQNLLCLKLAEELGVVI++P Sbjct: 245 LSLSAGSKPNDSSSRKLGSYLIQSQFQCAGNSSALFLTAAAQNLLCLKLAEELGVVISNP 304 Query: 182 WITWFKAASLPAFVSLLLTPYILYK 256 W++WFKAASLPA +SLL TP ILYK Sbjct: 305 WVSWFKAASLPAIISLLCTPLILYK 329 >ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata] gi|297312442|gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata] Length = 561 Score = 147 bits (370), Expect = 1e-33 Identities = 70/85 (82%), Positives = 80/85 (94%) Frame = +2 Query: 2 LSLSAGSKPNDPSAKKLGSYLIQSQFQCSGNSSGLYLTAAAQNLLCLKLAEELGVVIADP 181 LSLSAGSKP D S++KLGSYLIQSQFQC+GNSS L+LTAAAQNLLCLKLAEELGVVI++P Sbjct: 243 LSLSAGSKPGDSSSRKLGSYLIQSQFQCAGNSSALFLTAAAQNLLCLKLAEELGVVISNP 302 Query: 182 WITWFKAASLPAFVSLLLTPYILYK 256 W++WFKAASLPA +SLL TP+ILYK Sbjct: 303 WVSWFKAASLPAIISLLCTPFILYK 327 >dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila] Length = 561 Score = 146 bits (369), Expect = 2e-33 Identities = 71/85 (83%), Positives = 79/85 (92%) Frame = +2 Query: 2 LSLSAGSKPNDPSAKKLGSYLIQSQFQCSGNSSGLYLTAAAQNLLCLKLAEELGVVIADP 181 LSLSAGSKP D S++KLGSYLIQSQFQC+GNSS L+LTAAAQNLLCLKLAEELGVVIA+P Sbjct: 243 LSLSAGSKPGDSSSRKLGSYLIQSQFQCAGNSSALFLTAAAQNLLCLKLAEELGVVIANP 302 Query: 182 WITWFKAASLPAFVSLLLTPYILYK 256 W++WFKAASLPA +SLL TP ILYK Sbjct: 303 WVSWFKAASLPAIISLLCTPLILYK 327