BLASTX nr result
ID: Atractylodes22_contig00030523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030523 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322855.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|XP_004137961.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_003536980.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 emb|CBI32614.3| unnamed protein product [Vitis vinifera] 75 4e-12 ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 >ref|XP_002322855.1| predicted protein [Populus trichocarpa] gi|222867485|gb|EEF04616.1| predicted protein [Populus trichocarpa] Length = 751 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 161 NSYDDNLLSLLRQRKTEDAWHVYTQAPHLPTPTCLSRLICQLSYQNTPSALTR 3 +S D LLSLLRQRKTE+AW +YTQ PHLP PTCLSRL+ QLSYQNTP +L R Sbjct: 73 SSNDQTLLSLLRQRKTEEAWVLYTQTPHLPPPTCLSRLVSQLSYQNTPLSLRR 125 >ref|XP_004137961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Cucumis sativus] gi|449483612|ref|XP_004156638.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Cucumis sativus] Length = 736 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -2 Query: 161 NSYDDNLLSLLRQRKTEDAWHVYTQAPHLPTPTCLSRLICQLSYQNTPSALTR 3 +S + LL LLRQRKT++AW YTQ LP+PTCLSRL+ QLSYQNTPS+LTR Sbjct: 65 SSLEQRLLLLLRQRKTDEAWITYTQCNDLPSPTCLSRLVSQLSYQNTPSSLTR 117 >ref|XP_003536980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Glycine max] Length = 716 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -2 Query: 152 DDNLLSLLRQRKTEDAWHVYTQAPHLPTPTCLSRLICQLSYQNTPSALTR 3 D LLSLLR RKTE+AW Y+ + HLP PTCLSRL+ QLSYQNT S+LTR Sbjct: 26 DQKLLSLLRDRKTEEAWLAYSHSTHLPNPTCLSRLVSQLSYQNTLSSLTR 75 >emb|CBI32614.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -2 Query: 170 PHRNSYDDNLLSLLRQRKTEDAWHVYTQAPHLPTPTCLSRLICQLSYQNTPSALTR 3 PH +S + LL+LLRQRKTE+AW Y Q LP+PTCLSRL+ QLSYQNT ALTR Sbjct: 84 PH-HSLNQTLLTLLRQRKTEEAWLTYVQCTQLPSPTCLSRLVSQLSYQNTHQALTR 138 >ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Vitis vinifera] Length = 749 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -2 Query: 170 PHRNSYDDNLLSLLRQRKTEDAWHVYTQAPHLPTPTCLSRLICQLSYQNTPSALTR 3 PH +S + LL+LLRQRKTE+AW Y Q LP+PTCLSRL+ QLSYQNT ALTR Sbjct: 76 PH-HSLNQTLLTLLRQRKTEEAWLTYVQCTQLPSPTCLSRLVSQLSYQNTHQALTR 130