BLASTX nr result
ID: Atractylodes22_contig00030431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030431 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ85720.1| unknown [Medicago truncatula] 65 8e-09 ref|XP_003538254.1| PREDICTED: peptide transporter PTR1-like [Gl... 62 4e-08 ref|XP_002313394.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002520427.1| peptide transporter, putative [Ricinus commu... 62 5e-08 emb|CAO02542.1| putative proton-dependent oligopeptide transport... 62 5e-08 >gb|ACJ85720.1| unknown [Medicago truncatula] Length = 517 Score = 64.7 bits (156), Expect = 8e-09 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 216 QEDDIYTQDGTVDYLNNPANKKKTGTWKACGFIL 317 +E+++YT+DGTVDYL NPAN+KKTGTWKAC FIL Sbjct: 2 EEENVYTKDGTVDYLGNPANRKKTGTWKACPFIL 35 >ref|XP_003538254.1| PREDICTED: peptide transporter PTR1-like [Glycine max] Length = 572 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 219 EDDIYTQDGTVDYLNNPANKKKTGTWKACGFIL 317 EDD YT+DGTVDY NPANKK+TGTWKAC FIL Sbjct: 3 EDDGYTKDGTVDYCGNPANKKETGTWKACPFIL 35 >ref|XP_002313394.1| predicted protein [Populus trichocarpa] gi|222849802|gb|EEE87349.1| predicted protein [Populus trichocarpa] Length = 570 Score = 62.4 bits (150), Expect = 4e-08 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 219 EDDIYTQDGTVDYLNNPANKKKTGTWKACGFIL 317 E+D+YT+DGTVDYL NPAN+K+TGTW+AC FI+ Sbjct: 3 EEDVYTKDGTVDYLGNPANRKETGTWRACPFII 35 >ref|XP_002520427.1| peptide transporter, putative [Ricinus communis] gi|223540269|gb|EEF41840.1| peptide transporter, putative [Ricinus communis] Length = 571 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 216 QEDDIYTQDGTVDYLNNPANKKKTGTWKACGFIL 317 +E+DIYT+DGTVDY NPA+KKKTGTW+AC FI+ Sbjct: 2 EEEDIYTKDGTVDYRGNPASKKKTGTWRACPFII 35 >emb|CAO02542.1| putative proton-dependent oligopeptide transport (POT) family protein [Vigna unguiculata] gi|149941222|emb|CAO02543.1| putative proton-dependent oligopeptide transport (POT) family protein [Vigna unguiculata] Length = 174 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 219 EDDIYTQDGTVDYLNNPANKKKTGTWKACGFIL 317 EDDIYT+DGTVD+ NPANKK+TGTW+AC FIL Sbjct: 3 EDDIYTKDGTVDHRGNPANKKETGTWRACPFIL 35