BLASTX nr result
ID: Atractylodes22_contig00030363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030363 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528206.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002528206.1| conserved hypothetical protein [Ricinus communis] gi|223532367|gb|EEF34163.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 4/89 (4%) Frame = +2 Query: 302 TRKDLIFNNVVSYLVSDSYMYNPLVCSQPTFDLPPPKPV----STSPGGEEEEMALPIGG 469 T + + VV YL SDSY++ PL+ S P D + S+S EM + G Sbjct: 18 TNRKTLLKKVVDYLKSDSYLFAPLISSSPRTDHFLASKIVSSTSSSTTTSAVEMKENMKG 77 Query: 470 RNKKFIEKVVDFLETDCYLYSPLLTKELV 556 + K+F EKV D+L++D YLY+P+ +LV Sbjct: 78 KKKRFAEKVGDYLKSDGYLYAPVFAPKLV 106