BLASTX nr result
ID: Atractylodes22_contig00030133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030133 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246... 59 4e-07 emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] 59 4e-07 >ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246918 [Vitis vinifera] Length = 604 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 132 RKPSRMSLSGSREKDKFLPFLCRYLSRKKVVMLILVSFALMAFL 1 RKPS+M SGSREK++ LP+L R+LSR++V MLILV FA + FL Sbjct: 33 RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFL 76 >emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] Length = 616 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 132 RKPSRMSLSGSREKDKFLPFLCRYLSRKKVVMLILVSFALMAFL 1 RKPS+M SGSREK++ LP+L R+LSR++V MLILV FA + FL Sbjct: 33 RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFL 76