BLASTX nr result
ID: Atractylodes22_contig00029897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029897 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516518.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002516518.1| conserved hypothetical protein [Ricinus communis] gi|223544338|gb|EEF45859.1| conserved hypothetical protein [Ricinus communis] Length = 193 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/62 (54%), Positives = 43/62 (69%) Frame = -1 Query: 186 MSPDRDVLMASYNNAKITHCNLQKPSKLSMDTLQRTISDISFELSKEVDAVADHLKLPPI 7 M+P+ + L+ SY+N +QKPS+LSM+ LQRTISDISFELSKE A LPPI Sbjct: 1 MAPNGETLVGSYSNRDNI---VQKPSRLSMEGLQRTISDISFELSKETAATDSSSILPPI 57 Query: 6 SE 1 +E Sbjct: 58 TE 59