BLASTX nr result
ID: Atractylodes22_contig00029875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029875 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510090.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_002285345.1| PREDICTED: uncharacterized protein LOC100259... 55 5e-06 >ref|XP_002510090.1| conserved hypothetical protein [Ricinus communis] gi|223550791|gb|EEF52277.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/71 (43%), Positives = 46/71 (64%) Frame = -3 Query: 258 ILVFLVFFGRSFAIVCTTLGWYLMPTINATSESPKRQKKIVKKEYLLKSSEKMINSPRSV 79 IL+FL FFGRS AI+CT++GWY++PT+++ SPK K KK+ + + SE SPR+ Sbjct: 176 ILLFLAFFGRSVAILCTSIGWYIVPTLSSKRPSPKLAK---KKQLVRRLSE---ISPRTR 229 Query: 78 FNNESMNNQPH 46 ++ PH Sbjct: 230 NIDDPKGKSPH 240 >ref|XP_002285345.1| PREDICTED: uncharacterized protein LOC100259057 [Vitis vinifera] Length = 250 Score = 55.5 bits (132), Expect = 5e-06 Identities = 35/82 (42%), Positives = 45/82 (54%), Gaps = 9/82 (10%) Frame = -3 Query: 258 ILVFLVFFGRSFAIVCTTLGWYLMPTINATSESPKRQKKIVKKEYLLKSSEKMI-----N 94 IL L FGRS AI+CT LGWYL+P I S S +K KKEY+ + S+KM+ + Sbjct: 168 ILFLLTVFGRSVAILCTCLGWYLVPAIKGGS-SLDTKKPTKKKEYVRRKSDKMVVSDGSS 226 Query: 93 SPRS----VFNNESMNNQPHRK 40 SP++ N S HRK Sbjct: 227 SPKTNKTRAVNVTSPGQHGHRK 248