BLASTX nr result
ID: Atractylodes22_contig00029756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029756 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270778.1| PREDICTED: uncharacterized protein LOC100259... 54 1e-05 emb|CAN69700.1| hypothetical protein VITISV_003292 [Vitis vinifera] 54 1e-05 >ref|XP_002270778.1| PREDICTED: uncharacterized protein LOC100259352 [Vitis vinifera] Length = 418 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/33 (84%), Positives = 28/33 (84%), Gaps = 3/33 (9%) Frame = +3 Query: 3 MERSYSGNVR---VLNVPVCSLRGGSKSGGVFG 92 MERSYS NVR VLNVPVCSLRG SKSGGVFG Sbjct: 351 MERSYSANVRITPVLNVPVCSLRGSSKSGGVFG 383 >emb|CAN69700.1| hypothetical protein VITISV_003292 [Vitis vinifera] Length = 389 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/33 (84%), Positives = 28/33 (84%), Gaps = 3/33 (9%) Frame = +3 Query: 3 MERSYSGNVR---VLNVPVCSLRGGSKSGGVFG 92 MERSYS NVR VLNVPVCSLRG SKSGGVFG Sbjct: 322 MERSYSANVRITPVLNVPVCSLRGSSKSGGVFG 354