BLASTX nr result
ID: Atractylodes22_contig00029362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029362 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142726.1| PREDICTED: RING finger and transmembrane dom... 117 7e-25 ref|XP_003552333.1| PREDICTED: RING finger and transmembrane dom... 117 7e-25 ref|XP_003623658.1| RING finger protein [Medicago truncatula] gi... 117 7e-25 ref|XP_002531811.1| protein binding protein, putative [Ricinus c... 117 7e-25 ref|XP_002323102.1| predicted protein [Populus trichocarpa] gi|2... 117 7e-25 >ref|XP_004142726.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Cucumis sativus] gi|449502691|ref|XP_004161715.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Cucumis sativus] Length = 471 Score = 117 bits (294), Expect = 7e-25 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -1 Query: 217 VCAICQEKMHAPVVLRCKHVFCEDCVSEWFERERTCPLCRALVRAADLKSFGDGST 50 +CAICQEKMHAP++LRCKH+FCEDCVSEWFERERTCPLCRALV+ ADL+SFGDGST Sbjct: 409 LCAICQEKMHAPILLRCKHIFCEDCVSEWFERERTCPLCRALVKPADLRSFGDGST 464 >ref|XP_003552333.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Glycine max] Length = 440 Score = 117 bits (294), Expect = 7e-25 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -1 Query: 217 VCAICQEKMHAPVVLRCKHVFCEDCVSEWFERERTCPLCRALVRAADLKSFGDGST 50 +CAICQEKMHAP++LRCKH+FCEDCVSEWFERERTCPLCRALV+ ADL+SFGDGST Sbjct: 378 LCAICQEKMHAPILLRCKHIFCEDCVSEWFERERTCPLCRALVKPADLRSFGDGST 433 >ref|XP_003623658.1| RING finger protein [Medicago truncatula] gi|355498673|gb|AES79876.1| RING finger protein [Medicago truncatula] Length = 426 Score = 117 bits (294), Expect = 7e-25 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -1 Query: 217 VCAICQEKMHAPVVLRCKHVFCEDCVSEWFERERTCPLCRALVRAADLKSFGDGST 50 +CAICQEKMHAP++LRCKH+FCEDCVSEWFERERTCPLCRALV+ ADL+SFGDGST Sbjct: 364 LCAICQEKMHAPILLRCKHIFCEDCVSEWFERERTCPLCRALVKPADLRSFGDGST 419 >ref|XP_002531811.1| protein binding protein, putative [Ricinus communis] gi|223528545|gb|EEF30568.1| protein binding protein, putative [Ricinus communis] Length = 475 Score = 117 bits (294), Expect = 7e-25 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -1 Query: 217 VCAICQEKMHAPVVLRCKHVFCEDCVSEWFERERTCPLCRALVRAADLKSFGDGST 50 +CAICQEKMHAP++LRCKH+FCEDCVSEWFERERTCPLCRALV+ ADL+SFGDGST Sbjct: 413 LCAICQEKMHAPILLRCKHIFCEDCVSEWFERERTCPLCRALVKPADLRSFGDGST 468 >ref|XP_002323102.1| predicted protein [Populus trichocarpa] gi|222867732|gb|EEF04863.1| predicted protein [Populus trichocarpa] Length = 444 Score = 117 bits (294), Expect = 7e-25 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -1 Query: 217 VCAICQEKMHAPVVLRCKHVFCEDCVSEWFERERTCPLCRALVRAADLKSFGDGST 50 +CAICQEKMHAP++LRCKH+FCEDCVSEWFERERTCPLCRALV+ ADL+SFGDGST Sbjct: 382 LCAICQEKMHAPILLRCKHIFCEDCVSEWFERERTCPLCRALVKPADLRSFGDGST 437