BLASTX nr result
ID: Atractylodes22_contig00029282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029282 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana... 182 3e-44 gb|ACU24330.1| unknown [Glycine max] 177 8e-43 ref|XP_002526432.1| elongation factor 1 gamma, putative [Ricinus... 177 1e-42 gb|ACP43319.1| translation elongation factor [Citrus maxima] 176 2e-42 gb|ACJ84953.1| unknown [Medicago truncatula] 176 2e-42 >gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum] Length = 417 Score = 182 bits (461), Expect = 3e-44 Identities = 84/93 (90%), Positives = 89/93 (95%) Frame = -3 Query: 297 VGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGKDIPKFVMDECYDMELYEWKQV 118 VGGFLQRMDLARKYAFGKML+IGSE P+KVKGLWLFRGK+IPKFVMDECYDMELYEWK+V Sbjct: 325 VGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEV 384 Query: 117 DITDGDQKERVNQMIEDFEPFEGEALLDAKCFK 19 DI D QKERVNQMIED+EPFEGEALLDAKCFK Sbjct: 385 DINDESQKERVNQMIEDYEPFEGEALLDAKCFK 417 >gb|ACU24330.1| unknown [Glycine max] Length = 255 Score = 177 bits (449), Expect = 8e-43 Identities = 82/93 (88%), Positives = 89/93 (95%) Frame = -3 Query: 297 VGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGKDIPKFVMDECYDMELYEWKQV 118 VGGFLQRMDLARKYAFGKML+IGS PPFKVKGLWLFRG++IPKFV+DECYDMELYEW +V Sbjct: 163 VGGFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKV 222 Query: 117 DITDGDQKERVNQMIEDFEPFEGEALLDAKCFK 19 DI+D QKERVNQMIED+EPFEGEALLDAKCFK Sbjct: 223 DISDEAQKERVNQMIEDYEPFEGEALLDAKCFK 255 >ref|XP_002526432.1| elongation factor 1 gamma, putative [Ricinus communis] gi|223534212|gb|EEF35927.1| elongation factor 1 gamma, putative [Ricinus communis] Length = 307 Score = 177 bits (448), Expect = 1e-42 Identities = 80/93 (86%), Positives = 90/93 (96%) Frame = -3 Query: 297 VGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGKDIPKFVMDECYDMELYEWKQV 118 VGGFLQRMDLARKYAFGKML+IGS PP+KVKGLWLFRG++IP+FV+DECYDMELY+WK+V Sbjct: 215 VGGFLQRMDLARKYAFGKMLVIGSNPPYKVKGLWLFRGQEIPQFVIDECYDMELYDWKKV 274 Query: 117 DITDGDQKERVNQMIEDFEPFEGEALLDAKCFK 19 D++D QKERVNQMIEDFEPFEGEALLDAKCFK Sbjct: 275 DLSDEAQKERVNQMIEDFEPFEGEALLDAKCFK 307 >gb|ACP43319.1| translation elongation factor [Citrus maxima] Length = 418 Score = 176 bits (446), Expect = 2e-42 Identities = 81/93 (87%), Positives = 88/93 (94%) Frame = -3 Query: 297 VGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGKDIPKFVMDECYDMELYEWKQV 118 V GFLQRMDLARKYAFGKMLIIG+EPP+KVKGLWLFRG +IPKFVMDECYDMELY+WK+ Sbjct: 326 VSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKA 385 Query: 117 DITDGDQKERVNQMIEDFEPFEGEALLDAKCFK 19 DI+D +QKERVNQMIED EPFEGEALLDAKCFK Sbjct: 386 DISDEEQKERVNQMIEDHEPFEGEALLDAKCFK 418 >gb|ACJ84953.1| unknown [Medicago truncatula] Length = 149 Score = 176 bits (446), Expect = 2e-42 Identities = 82/93 (88%), Positives = 87/93 (93%) Frame = -3 Query: 297 VGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGKDIPKFVMDECYDMELYEWKQV 118 VGGFLQRMDLARKYAFGKML+IG EPPFKVKGLWLFRG++IPKFVMDECYDMELYEW +V Sbjct: 57 VGGFLQRMDLARKYAFGKMLVIGFEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKV 116 Query: 117 DITDGDQKERVNQMIEDFEPFEGEALLDAKCFK 19 DI+D QKERV QMIEDFEPFEGE LLDAKCFK Sbjct: 117 DISDEAQKERVGQMIEDFEPFEGEPLLDAKCFK 149