BLASTX nr result
ID: Atractylodes22_contig00029105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029105 (191 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX75363.1| hypothetical protein LBL9 [Panax quinquefolius] 86 3e-15 ref|XP_002271827.2| PREDICTED: interactor of constitutive active... 85 7e-15 emb|CBI32925.3| unnamed protein product [Vitis vinifera] 85 7e-15 emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] 85 7e-15 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 83 2e-14 >gb|ABX75363.1| hypothetical protein LBL9 [Panax quinquefolius] Length = 245 Score = 85.9 bits (211), Expect = 3e-15 Identities = 43/62 (69%), Positives = 52/62 (83%) Frame = +2 Query: 5 KMKSKLNQLEEEFKKSKNEGIQLKEKLKEVEGAKEALETEMKKLRVQTEQWRKAADAAAS 184 +M+S+LNQL EE + SK+ +QL +K VEGAKEALE EMKKLRVQTEQWRKAADAAA+ Sbjct: 110 EMQSRLNQLGEELETSKDNIVQLNQKFGAVEGAKEALEIEMKKLRVQTEQWRKAADAAAA 169 Query: 185 IL 190 +L Sbjct: 170 VL 171 >ref|XP_002271827.2| PREDICTED: interactor of constitutive active ROPs 4-like [Vitis vinifera] Length = 346 Score = 84.7 bits (208), Expect = 7e-15 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = +2 Query: 2 EKMKSKLNQLEEEFKKSKNEGIQLKEKLKEVEGAKEALETEMKKLRVQTEQWRKAADAAA 181 E+M +L+QL E+ K +K QLKEKL+ VEG KEALE EMKKLRVQTEQWRKAADAAA Sbjct: 211 EEMALRLSQLGEDLKANKANEAQLKEKLEAVEGVKEALEAEMKKLRVQTEQWRKAADAAA 270 Query: 182 SIL 190 ++L Sbjct: 271 AVL 273 >emb|CBI32925.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 84.7 bits (208), Expect = 7e-15 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = +2 Query: 2 EKMKSKLNQLEEEFKKSKNEGIQLKEKLKEVEGAKEALETEMKKLRVQTEQWRKAADAAA 181 E+M +L+QL E+ K +K QLKEKL+ VEG KEALE EMKKLRVQTEQWRKAADAAA Sbjct: 227 EEMALRLSQLGEDLKANKANEAQLKEKLEAVEGVKEALEAEMKKLRVQTEQWRKAADAAA 286 Query: 182 SIL 190 ++L Sbjct: 287 AVL 289 >emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] Length = 376 Score = 84.7 bits (208), Expect = 7e-15 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = +2 Query: 2 EKMKSKLNQLEEEFKKSKNEGIQLKEKLKEVEGAKEALETEMKKLRVQTEQWRKAADAAA 181 E+M +L+QL E+ K +K QLKEKL+ VEG KEALE EMKKLRVQTEQWRKAADAAA Sbjct: 241 EEMALRLSQLGEDLKANKANEAQLKEKLEAVEGVKEALEAEMKKLRVQTEQWRKAADAAA 300 Query: 182 SIL 190 ++L Sbjct: 301 AVL 303 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Glycine max] gi|356549542|ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Glycine max] Length = 377 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/63 (66%), Positives = 50/63 (79%) Frame = +2 Query: 2 EKMKSKLNQLEEEFKKSKNEGIQLKEKLKEVEGAKEALETEMKKLRVQTEQWRKAADAAA 181 E+M +LNQL EE + SK G +L EKLK +E KE LE+EMKKLRVQTEQWRKAADAAA Sbjct: 243 EEMTLQLNQLREELEASKANGDKLDEKLKSMEARKEGLESEMKKLRVQTEQWRKAADAAA 302 Query: 182 SIL 190 ++L Sbjct: 303 AVL 305