BLASTX nr result
ID: Atractylodes22_contig00029012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00029012 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611798.1| Misato-like protein [Medicago truncatula] gi... 60 1e-07 ref|XP_003537356.1| PREDICTED: protein misato homolog 1-like [Gl... 60 2e-07 ref|XP_003517285.1| PREDICTED: protein misato homolog 1-like [Gl... 60 2e-07 ref|XP_002263195.2| PREDICTED: protein misato homolog 1-like [Vi... 59 3e-07 ref|XP_002300359.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 >ref|XP_003611798.1| Misato-like protein [Medicago truncatula] gi|355513133|gb|AES94756.1| Misato-like protein [Medicago truncatula] Length = 566 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 93 MKELVTFQVGSYANFIGSHFWNFQDELLGL 4 MKE+VT QVG YAN++GSHFWNFQDELLGL Sbjct: 1 MKEIVTIQVGDYANYVGSHFWNFQDELLGL 30 >ref|XP_003537356.1| PREDICTED: protein misato homolog 1-like [Glycine max] Length = 572 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 93 MKELVTFQVGSYANFIGSHFWNFQDELLGL 4 MKE+VT QVG +ANF+GSHFWNFQDELLGL Sbjct: 1 MKEIVTVQVGDFANFVGSHFWNFQDELLGL 30 >ref|XP_003517285.1| PREDICTED: protein misato homolog 1-like [Glycine max] Length = 572 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 93 MKELVTFQVGSYANFIGSHFWNFQDELLGL 4 MKE+VT QVG +ANF+GSHFWNFQDELLGL Sbjct: 1 MKEIVTVQVGDFANFVGSHFWNFQDELLGL 30 >ref|XP_002263195.2| PREDICTED: protein misato homolog 1-like [Vitis vinifera] gi|302144155|emb|CBI23282.3| unnamed protein product [Vitis vinifera] Length = 575 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 93 MKELVTFQVGSYANFIGSHFWNFQDELLGL 4 M+E+VT QVG +ANFIGSHFWNFQDELLGL Sbjct: 1 MREIVTIQVGGFANFIGSHFWNFQDELLGL 30 >ref|XP_002300359.1| predicted protein [Populus trichocarpa] gi|222847617|gb|EEE85164.1| predicted protein [Populus trichocarpa] Length = 574 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 93 MKELVTFQVGSYANFIGSHFWNFQDELLGL 4 M+ELVT QVG +ANF+GSHFWNFQDELLGL Sbjct: 1 MRELVTVQVGGFANFVGSHFWNFQDELLGL 30