BLASTX nr result
ID: Atractylodes22_contig00028959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028959 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614566.1| hypothetical protein MTR_5g055560 [Medicago ... 58 9e-07 >ref|XP_003614566.1| hypothetical protein MTR_5g055560 [Medicago truncatula] gi|355515901|gb|AES97524.1| hypothetical protein MTR_5g055560 [Medicago truncatula] Length = 537 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = -3 Query: 197 LERMSMSFYLTNFPSSVSSKDIWDRCSSWGIVVDVFIPNRLSKAGKRFCFVRFIKVSN 24 L+ ++ F+ T P+ ++ DIW + +G VV+VFIPN+L K GKRF FV+F V N Sbjct: 97 LDTTTIPFFFTRIPNEANTTDIWSVFAKYGQVVEVFIPNKLDKWGKRFGFVKFKDVGN 154