BLASTX nr result
ID: Atractylodes22_contig00028926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028926 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thalia... 57 2e-06 ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana]... 57 2e-06 ref|NP_567421.1| F-box/LRR-repeat protein [Arabidopsis thaliana]... 56 3e-06 emb|CAB10188.1| hypothetical protein [Arabidopsis thaliana] gi|7... 56 3e-06 >ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332657973|gb|AEE83373.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 443 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/79 (43%), Positives = 49/79 (62%) Frame = +2 Query: 2 IDLDDSLHLNPSRKWSNSGLFLDFVDRVLSLNQSQTIVKFRLHIHDVSVYSMLRINGFIH 181 +DLDDS++LNP + S F+DFVDRVL+L + + KF L I D +RI +I+ Sbjct: 50 LDLDDSVYLNPENETEISTSFMDFVDRVLALQGNSPLHKFSLKIGD--GIDPVRIIPWIN 107 Query: 182 NVILRNVVEIDLGIFLHFE 238 NV+ R V ++DL + L E Sbjct: 108 NVLERGVSDLDLHLNLESE 126 >ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75245750|sp|Q8L7H1.1|FBL75_ARATH RecName: Full=F-box/LRR-repeat protein At4g14103 gi|22136642|gb|AAM91640.1| unknown protein [Arabidopsis thaliana] gi|332657972|gb|AEE83372.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 381 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/79 (43%), Positives = 49/79 (62%) Frame = +2 Query: 2 IDLDDSLHLNPSRKWSNSGLFLDFVDRVLSLNQSQTIVKFRLHIHDVSVYSMLRINGFIH 181 +DLDDS++LNP + S F+DFVDRVL+L + + KF L I D +RI +I+ Sbjct: 50 LDLDDSVYLNPENETEISTSFMDFVDRVLALQGNSPLHKFSLKIGD--GIDPVRIIPWIN 107 Query: 182 NVILRNVVEIDLGIFLHFE 238 NV+ R V ++DL + L E Sbjct: 108 NVLERGVSDLDLHLNLESE 126 >ref|NP_567421.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75249810|sp|Q94B46.1|FBL74_ARATH RecName: Full=F-box/LRR-repeat protein At4g14096 gi|14596145|gb|AAK68800.1| Unknown protein [Arabidopsis thaliana] gi|22136112|gb|AAM91134.1| unknown protein [Arabidopsis thaliana] gi|332657971|gb|AEE83371.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 468 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/79 (40%), Positives = 49/79 (62%) Frame = +2 Query: 2 IDLDDSLHLNPSRKWSNSGLFLDFVDRVLSLNQSQTIVKFRLHIHDVSVYSMLRINGFIH 181 +DLD+S++LNP + S F+DFVDRVL+L + + KF L I D RI +I+ Sbjct: 50 LDLDESVYLNPENETEVSSSFMDFVDRVLALQGNSPLHKFSLKIGD--GVEPDRIIPWIN 107 Query: 182 NVILRNVVEIDLGIFLHFE 238 NV+ R V ++DL +++ E Sbjct: 108 NVLERGVSDLDLHVYMETE 126 >emb|CAB10188.1| hypothetical protein [Arabidopsis thaliana] gi|7268114|emb|CAB78451.1| hypothetical protein [Arabidopsis thaliana] Length = 1047 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/79 (40%), Positives = 49/79 (62%) Frame = +2 Query: 2 IDLDDSLHLNPSRKWSNSGLFLDFVDRVLSLNQSQTIVKFRLHIHDVSVYSMLRINGFIH 181 +DLD+S++LNP + S F+DFVDRVL+L + + KF L I D RI +I+ Sbjct: 305 LDLDESVYLNPENETEVSSSFMDFVDRVLALQGNSPLHKFSLKIGD--GVEPDRIIPWIN 362 Query: 182 NVILRNVVEIDLGIFLHFE 238 NV+ R V ++DL +++ E Sbjct: 363 NVLERGVSDLDLHVYMETE 381