BLASTX nr result
ID: Atractylodes22_contig00028859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028859 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305268.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002513640.1| ornithine cyclodeaminase, putative [Ricinus ... 57 2e-06 >ref|XP_002305268.1| predicted protein [Populus trichocarpa] gi|222848232|gb|EEE85779.1| predicted protein [Populus trichocarpa] Length = 316 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 103 PYIGIKLVTTHPNNSALNLPGVHAGYVLFNSITG 2 PYIG+KLVT P NSALNLPG+HA YVLF+S TG Sbjct: 62 PYIGVKLVTYFPQNSALNLPGIHASYVLFSSTTG 95 >ref|XP_002513640.1| ornithine cyclodeaminase, putative [Ricinus communis] gi|223547548|gb|EEF49043.1| ornithine cyclodeaminase, putative [Ricinus communis] Length = 334 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 103 PYIGIKLVTTHPNNSALNLPGVHAGYVLFNSITG 2 PYIG+KLVT P NS LNLPG+HA YVLF+S TG Sbjct: 76 PYIGVKLVTHFPQNSMLNLPGIHASYVLFSSTTG 109