BLASTX nr result
ID: Atractylodes22_contig00028753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028753 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516927.1| sentrin/sumo-specific protease, putative [Ri... 96 4e-18 ref|XP_004170858.1| PREDICTED: ubiquitin-like-specific protease ... 95 5e-18 ref|XP_004148212.1| PREDICTED: ubiquitin-like-specific protease ... 95 5e-18 ref|XP_002333430.1| predicted protein [Populus trichocarpa] gi|2... 95 5e-18 ref|XP_002332256.1| predicted protein [Populus trichocarpa] gi|2... 95 5e-18 >ref|XP_002516927.1| sentrin/sumo-specific protease, putative [Ricinus communis] gi|223544015|gb|EEF45541.1| sentrin/sumo-specific protease, putative [Ricinus communis] Length = 492 Score = 95.5 bits (236), Expect = 4e-18 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -1 Query: 466 LPNQENGFDCGVFMIKYADFYSRDIGLCFKQEHMPYFRRRTAKEILTLRAE 314 LP Q+NG+DCGVFMIKYADFYSR IGLCF QEHMPYFR RTAKEIL LRA+ Sbjct: 442 LPEQQNGYDCGVFMIKYADFYSRGIGLCFGQEHMPYFRMRTAKEILRLRAD 492 >ref|XP_004170858.1| PREDICTED: ubiquitin-like-specific protease 1A-like, partial [Cucumis sativus] Length = 79 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = -1 Query: 466 LPNQENGFDCGVFMIKYADFYSRDIGLCFKQEHMPYFRRRTAKEILTLRA 317 LP QENGFDCG+FMIKYADFYSR + LCFKQEHMPYFR RTAKEIL LRA Sbjct: 29 LPEQENGFDCGMFMIKYADFYSRGLNLCFKQEHMPYFRLRTAKEILKLRA 78 >ref|XP_004148212.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Cucumis sativus] Length = 501 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = -1 Query: 466 LPNQENGFDCGVFMIKYADFYSRDIGLCFKQEHMPYFRRRTAKEILTLRA 317 LP QENGFDCG+FMIKYADFYSR + LCFKQEHMPYFR RTAKEIL LRA Sbjct: 451 LPEQENGFDCGMFMIKYADFYSRGLNLCFKQEHMPYFRLRTAKEILKLRA 500 >ref|XP_002333430.1| predicted protein [Populus trichocarpa] gi|222836624|gb|EEE75017.1| predicted protein [Populus trichocarpa] Length = 56 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -1 Query: 466 LPNQENGFDCGVFMIKYADFYSRDIGLCFKQEHMPYFRRRTAKEILTLRAE 314 LP Q+NG+DCGVFMIKYADFYSR IGLCF QEHMPYFR RTAKEIL LRA+ Sbjct: 6 LPEQQNGYDCGVFMIKYADFYSRGIGLCFGQEHMPYFRLRTAKEILRLRAD 56 >ref|XP_002332256.1| predicted protein [Populus trichocarpa] gi|222832021|gb|EEE70498.1| predicted protein [Populus trichocarpa] Length = 516 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -1 Query: 466 LPNQENGFDCGVFMIKYADFYSRDIGLCFKQEHMPYFRRRTAKEILTLRAE 314 LP Q+NG+DCGVFMIKYADFYSR IGLCF QEHMPYFR RTAKEIL LRA+ Sbjct: 466 LPEQQNGYDCGVFMIKYADFYSRGIGLCFGQEHMPYFRLRTAKEILRLRAD 516