BLASTX nr result
ID: Atractylodes22_contig00028638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028638 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002445911.1| hypothetical protein SORBIDRAFT_07g027900 [S... 57 2e-06 >ref|XP_002445911.1| hypothetical protein SORBIDRAFT_07g027900 [Sorghum bicolor] gi|241942261|gb|EES15406.1| hypothetical protein SORBIDRAFT_07g027900 [Sorghum bicolor] Length = 364 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +2 Query: 218 MSSPSTRPESPIVLGFGGVSVDLLATVASYPSPDDKIRS 334 M+S S+ SP+VLG GG+S+D LATVAS+P+PDDKIRS Sbjct: 1 MASASSGTPSPVVLGCGGISIDYLATVASFPNPDDKIRS 39