BLASTX nr result
ID: Atractylodes22_contig00028616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028616 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36826.1| SPL domain class transcription factor [Malus x do... 88 6e-16 ref|XP_002533086.1| Squamosa promoter-binding protein, putative ... 88 8e-16 ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like pr... 87 1e-15 gb|ADY75712.1| SPL3-like protein [Eucalyptus globulus] 87 1e-15 ref|XP_002280052.1| PREDICTED: squamosa promoter-binding protein... 86 2e-15 >gb|ADL36826.1| SPL domain class transcription factor [Malus x domestica] Length = 189 Score = 88.2 bits (217), Expect = 6e-16 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = -1 Query: 333 RFCQQCSRFHDLTEFDDAKRSCRRRLAGHNERRRKSSYETYGESS*L*MRKVLNDERK 160 RFCQQCSRFH+L EFD+AKRSCRRRLAGHNERRRKSS E YGESS R+V+ + K Sbjct: 113 RFCQQCSRFHELIEFDEAKRSCRRRLAGHNERRRKSSGEPYGESS---SRRVVGHQYK 167 >ref|XP_002533086.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223527125|gb|EEF29301.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 198 Score = 87.8 bits (216), Expect = 8e-16 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -1 Query: 333 RFCQQCSRFHDLTEFDDAKRSCRRRLAGHNERRRKSSYETYGESS 199 RFCQQCSRFH+L EFD+AKRSCRRRLAGHNERRRKSS E+YGE S Sbjct: 112 RFCQQCSRFHELVEFDEAKRSCRRRLAGHNERRRKSSAESYGEGS 156 >ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis sativus] gi|449517046|ref|XP_004165557.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis sativus] Length = 202 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -1 Query: 333 RFCQQCSRFHDLTEFDDAKRSCRRRLAGHNERRRKSSYETYGESS 199 RFCQQCSRFH+LTEFD+AKRSCRRRLAGHNERRRKSS E+ GES+ Sbjct: 115 RFCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKSSAESQGEST 159 >gb|ADY75712.1| SPL3-like protein [Eucalyptus globulus] Length = 147 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -1 Query: 333 RFCQQCSRFHDLTEFDDAKRSCRRRLAGHNERRRKSSYETYGESS 199 RFCQQCSRFH+L+EFD+AKRSCRRRLAGHNERRRKSSY+ GE S Sbjct: 102 RFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSYDNQGEGS 146 >ref|XP_002280052.1| PREDICTED: squamosa promoter-binding protein 1 [Vitis vinifera] gi|297740409|emb|CBI30591.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 86.3 bits (212), Expect = 2e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -1 Query: 333 RFCQQCSRFHDLTEFDDAKRSCRRRLAGHNERRRKSSYETYGESS 199 RFCQQCSRFH+L+EFDD KRSCRRRLAGHNERRRKSS E++GE S Sbjct: 95 RFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKSSSESHGEGS 139