BLASTX nr result
ID: Atractylodes22_contig00028415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028415 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631260.1| PREDICTED: uncharacterized protein LOC100852... 60 2e-07 ref|XP_003517721.1| PREDICTED: uncharacterized protein LOC100805... 56 3e-06 ref|XP_002524645.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 ref|XP_002888779.1| hypothetical protein ARALYDRAFT_476162 [Arab... 55 8e-06 >ref|XP_003631260.1| PREDICTED: uncharacterized protein LOC100852726 [Vitis vinifera] Length = 339 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = +1 Query: 19 SAHE-VYLKQRGGEED-RRRSYLPYRPGLMGFFTNVNGGLSRNVHPF 153 SAHE +Y+K R E RR+SYLPYR L+GFFTNVN GLSRNVHPF Sbjct: 294 SAHESLYIKNRALREGGRRKSYLPYRQDLVGFFTNVN-GLSRNVHPF 339 >ref|XP_003517721.1| PREDICTED: uncharacterized protein LOC100805151 [Glycine max] Length = 251 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 10 ATASAHEV-YLKQRGGEE-DRRRSYLPYRPGLMGFFTNVNGGLSRNVHPF 153 A ASAHE Y+ R +E D+R+SYLPY+ ++GFF N N GLSRNVHP+ Sbjct: 203 AAASAHEKHYIMSRARKESDKRKSYLPYKQNMLGFFANAN-GLSRNVHPY 251 >ref|XP_002524645.1| conserved hypothetical protein [Ricinus communis] gi|223536006|gb|EEF37664.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = +1 Query: 4 KKATASAHEV-YLKQRGGEE-DRRRSYLPYRPGLMGFFTNVNGGLSRNVHPF 153 K ASAHEV Y++ + +E D+RRSYLPYR GL+GFF NVN G R+V PF Sbjct: 233 KDKIASAHEVFYVRSKALKEGDKRRSYLPYRQGLVGFFANVN-GFGRSVPPF 283 >ref|XP_002888779.1| hypothetical protein ARALYDRAFT_476162 [Arabidopsis lyrata subsp. lyrata] gi|297334620|gb|EFH65038.1| hypothetical protein ARALYDRAFT_476162 [Arabidopsis lyrata subsp. lyrata] Length = 258 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/52 (61%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +1 Query: 4 KKATASAHE-VYLKQRG-GEEDRRRSYLPYRPGLMGFFTNVNGGLSRNVHPF 153 K T SAHE +Y++ R EE +RRSYLPY+ +GFFTNVN GL+RNVHPF Sbjct: 210 KMRTKSAHEKLYMRNRAMREEGKRRSYLPYQH--VGFFTNVN-GLTRNVHPF 258