BLASTX nr result
ID: Atractylodes22_contig00028279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028279 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii] 61 1e-07 ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus c... 55 8e-06 >gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii] Length = 456 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +1 Query: 1 MALLSDAIYKST-TQLNGDYVNVDPNNSL*IHDLQVVEKCLERIYLHHILEPSWETSNTL 177 M L+SD IY+S NG+YV++DPNN L ++DLQ V+KCL I HHILE +W + L Sbjct: 228 MGLISDKIYQSAKANCNGNYVDIDPNNILCLNDLQKVKKCLNNIQSHHILE-NWCDLSLL 286 Query: 178 KS 183 +S Sbjct: 287 RS 288 >ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus communis] gi|223535451|gb|EEF37121.1| serine carboxypeptidase, putative [Ricinus communis] Length = 596 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +1 Query: 1 MALLSDAIYKSTTQ-LNGDYVNVDPNNSL*IHDLQVVEKCLERIYLHHILEPSWETS 168 MA++SD +YKS + G+YV V+PNN+ + DL+ + KC RI HILEP T+ Sbjct: 246 MAIISDELYKSAKRNCKGEYVKVNPNNTKCLDDLEAISKCTSRIKKSHILEPQCSTT 302