BLASTX nr result
ID: Atractylodes22_contig00028090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00028090 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307259.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002310152.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002877755.1| hypothetical protein ARALYDRAFT_485408 [Arab... 69 4e-10 ref|NP_190631.2| nodulation-related protein [Arabidopsis thalian... 69 4e-10 ref|XP_002522303.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 >ref|XP_002307259.1| predicted protein [Populus trichocarpa] gi|222856708|gb|EEE94255.1| predicted protein [Populus trichocarpa] Length = 342 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 380 SQQVKIHKGALSEHIKNWEEVNKTLSGTPYEKFLQADY 267 S+QVKIHKG LS+H+KNWE+VNKTL+GT YE FLQADY Sbjct: 305 SRQVKIHKGPLSDHVKNWEDVNKTLNGTAYESFLQADY 342 >ref|XP_002310152.1| predicted protein [Populus trichocarpa] gi|222853055|gb|EEE90602.1| predicted protein [Populus trichocarpa] Length = 342 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 380 SQQVKIHKGALSEHIKNWEEVNKTLSGTPYEKFLQADY 267 S+QVKIHKG LS+H+KNWE++NKTL+GT YE FLQADY Sbjct: 305 SRQVKIHKGPLSDHVKNWEDINKTLNGTAYESFLQADY 342 >ref|XP_002877755.1| hypothetical protein ARALYDRAFT_485408 [Arabidopsis lyrata subsp. lyrata] gi|297323593|gb|EFH54014.1| hypothetical protein ARALYDRAFT_485408 [Arabidopsis lyrata subsp. lyrata] Length = 340 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 380 SQQVKIHKGALSEHIKNWEEVNKTLSGTPYEKFLQADY 267 S+QVKIH+G LS+HIKNWE++NKTL+GT YEKFL+ADY Sbjct: 303 SRQVKIHRGDLSDHIKNWEDINKTLNGTEYEKFLRADY 340 >ref|NP_190631.2| nodulation-related protein [Arabidopsis thaliana] gi|45773806|gb|AAS76707.1| At3g50620 [Arabidopsis thaliana] gi|114050671|gb|ABI49485.1| At3g50620 [Arabidopsis thaliana] gi|332645165|gb|AEE78686.1| nodulation-related protein [Arabidopsis thaliana] Length = 340 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 380 SQQVKIHKGALSEHIKNWEEVNKTLSGTPYEKFLQADY 267 S+QVKIH+G LS+HIKNWE++NKTL+GT YEKFL+ADY Sbjct: 303 SRQVKIHRGDLSDHIKNWEDINKTLNGTEYEKFLRADY 340 >ref|XP_002522303.1| conserved hypothetical protein [Ricinus communis] gi|223538381|gb|EEF39987.1| conserved hypothetical protein [Ricinus communis] Length = 329 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 380 SQQVKIHKGALSEHIKNWEEVNKTLSGTPYEKFLQADY 267 S+QVKIHKG LS+HIKNWE+VNK L+GT YE FL+ADY Sbjct: 292 SRQVKIHKGPLSDHIKNWEDVNKALTGTAYESFLEADY 329