BLASTX nr result
ID: Atractylodes22_contig00027831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00027831 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEF38425.1| 5-methylcytosine DNA glycosylase [Triticum aestivum] 92 4e-17 gb|AEF38424.1| 5-methylcytosine DNA glycosylase [Triticum aestivum] 92 4e-17 gb|AEF38423.1| 5-methylcytosine DNA glycosylase [Triticum aestivum] 92 4e-17 emb|CAQ58412.1| putative transcriptional activator DEMETER [Hord... 92 4e-17 gb|AFW65705.1| hypothetical protein ZEAMMB73_319662 [Zea mays] 90 2e-16 >gb|AEF38425.1| 5-methylcytosine DNA glycosylase [Triticum aestivum] Length = 1981 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +2 Query: 2 VPRCLLWDLPRRDVGCGTSATSIFKALTTSDIQRCFWRGSICVRGFNRQTRQPRPLHRRF 181 VPR +WDLPRR V GTS SIFK LTT DIQ+CFWRG +CVRGF+R +R PRPL+ R Sbjct: 1900 VPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPLYARL 1959 Query: 182 H 184 H Sbjct: 1960 H 1960 >gb|AEF38424.1| 5-methylcytosine DNA glycosylase [Triticum aestivum] Length = 1982 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +2 Query: 2 VPRCLLWDLPRRDVGCGTSATSIFKALTTSDIQRCFWRGSICVRGFNRQTRQPRPLHRRF 181 VPR +WDLPRR V GTS SIFK LTT DIQ+CFWRG +CVRGF+R +R PRPL+ R Sbjct: 1901 VPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPLYARL 1960 Query: 182 H 184 H Sbjct: 1961 H 1961 >gb|AEF38423.1| 5-methylcytosine DNA glycosylase [Triticum aestivum] Length = 1975 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +2 Query: 2 VPRCLLWDLPRRDVGCGTSATSIFKALTTSDIQRCFWRGSICVRGFNRQTRQPRPLHRRF 181 VPR +WDLPRR V GTS SIFK LTT DIQ+CFWRG +CVRGF+R +R PRPL+ R Sbjct: 1894 VPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPLYARL 1953 Query: 182 H 184 H Sbjct: 1954 H 1954 >emb|CAQ58412.1| putative transcriptional activator DEMETER [Hordeum vulgare subsp. vulgare] Length = 1981 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = +2 Query: 2 VPRCLLWDLPRRDVGCGTSATSIFKALTTSDIQRCFWRGSICVRGFNRQTRQPRPLHRRF 181 VPR +WDLPRR V GTS SIFK LTT DIQ+CFWRG +CVRGF+R +R PRPL+ R Sbjct: 1900 VPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPLYARL 1959 Query: 182 H 184 H Sbjct: 1960 H 1960 >gb|AFW65705.1| hypothetical protein ZEAMMB73_319662 [Zea mays] Length = 1904 Score = 90.1 bits (222), Expect = 2e-16 Identities = 39/61 (63%), Positives = 46/61 (75%) Frame = +2 Query: 2 VPRCLLWDLPRRDVGCGTSATSIFKALTTSDIQRCFWRGSICVRGFNRQTRQPRPLHRRF 181 VPR +WDLPRR V GTS +IF+ LTT +IQRCFWRG +CVRGF+R R PRPL+ R Sbjct: 1825 VPRSWIWDLPRRTVYFGTSVPTIFRGLTTEEIQRCFWRGFVCVRGFDRTVRAPRPLYARL 1884 Query: 182 H 184 H Sbjct: 1885 H 1885