BLASTX nr result
ID: Atractylodes22_contig00027725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00027725 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322969.1| auxin influx carrier component [Populus tric... 59 3e-07 gb|ABN81349.1| auxin influx transport protein [Casuarina glauca]... 59 3e-07 emb|CCF23025.1| auxin influx carrier protein [Mangifera indica] ... 59 4e-07 ref|XP_002268925.1| PREDICTED: auxin transporter-like protein 2 ... 59 4e-07 emb|CAN76469.1| hypothetical protein VITISV_030043 [Vitis vinifera] 59 4e-07 >ref|XP_002322969.1| auxin influx carrier component [Populus trichocarpa] gi|222867599|gb|EEF04730.1| auxin influx carrier component [Populus trichocarpa] Length = 477 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 4/42 (9%) Frame = +1 Query: 4 AFGDQLLNHSNVFSLLPRTGFHDATIIIVVIHQI----FSCT 117 AFGDQLLNHSN F+LLPR GF DA +I+++IHQ F+CT Sbjct: 289 AFGDQLLNHSNAFALLPRNGFRDAAVILMLIHQFITFGFACT 330 >gb|ABN81349.1| auxin influx transport protein [Casuarina glauca] gi|126217794|gb|ABN81350.1| auxin influx transport protein [Casuarina glauca] Length = 480 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 4/42 (9%) Frame = +1 Query: 4 AFGDQLLNHSNVFSLLPRTGFHDATIIIVVIHQI----FSCT 117 AFGD+LLNHSN FSLLPR GF DA +I+++IHQ F+CT Sbjct: 288 AFGDELLNHSNAFSLLPRNGFRDAAVILMLIHQFITFGFACT 329 >emb|CCF23025.1| auxin influx carrier protein [Mangifera indica] gi|381280181|gb|AFG18185.1| auxin influx carrier component [Mangifera indica] Length = 481 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 4/42 (9%) Frame = +1 Query: 4 AFGDQLLNHSNVFSLLPRTGFHDATIIIVVIHQI----FSCT 117 AFGDQLLNHSN FSLLPRTG+ D +I+++IHQ F+CT Sbjct: 289 AFGDQLLNHSNAFSLLPRTGWRDTAVILMLIHQFITFGFACT 330 >ref|XP_002268925.1| PREDICTED: auxin transporter-like protein 2 [Vitis vinifera] gi|297736635|emb|CBI25506.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = +1 Query: 4 AFGDQLLNHSNVFSLLPRTGFHDATIIIVVIHQI----FSCT 117 AFGDQLL+HSN FSLLP+TGF DA +I+++IHQ F+CT Sbjct: 287 AFGDQLLDHSNAFSLLPQTGFRDAAVILMLIHQFITFGFACT 328 >emb|CAN76469.1| hypothetical protein VITISV_030043 [Vitis vinifera] Length = 872 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = +1 Query: 4 AFGDQLLNHSNVFSLLPRTGFHDATIIIVVIHQI----FSCT 117 AFGDQLL+HSN FSLLP+TGF DA +I+++IHQ F+CT Sbjct: 625 AFGDQLLDHSNAFSLLPQTGFRDAAVILMLIHQFITFGFACT 666