BLASTX nr result
ID: Atractylodes22_contig00027670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00027670 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241188.1| ATP-dependent zinc metalloprotease FTSH 8, c... 77 1e-12 ref|XP_003533707.1| PREDICTED: ATP-dependent zinc metalloproteas... 76 3e-12 gb|AAD17230.1| FtsH-like protein Pftf precursor [Nicotiana tabacum] 75 4e-12 dbj|BAE71245.1| putative zinc dependent protease [Trifolium prat... 75 6e-12 ref|XP_003531102.1| PREDICTED: ATP-dependent zinc metalloproteas... 75 7e-12 >ref|NP_001241188.1| ATP-dependent zinc metalloprotease FTSH 8, chloroplastic-like [Glycine max] gi|333973889|gb|AEG42190.1| filamentation temperature-sensitive H [Glycine max] Length = 690 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 MDKIVEVLLEKETMSGDEFRAILSEFVEIPVENRVLPAAPSPVSV 135 +DKIVEVLLEKETMSGDEFRA+LSEFVEIP ENRV P+ PSPV V Sbjct: 646 IDKIVEVLLEKETMSGDEFRALLSEFVEIPAENRVPPSTPSPVVV 690 >ref|XP_003533707.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, chloroplastic-like [Glycine max] Length = 688 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 1 MDKIVEVLLEKETMSGDEFRAILSEFVEIPVENRVLPAAPSPVSV 135 +DKIVEVLLE ETMSGDEFRA+LSEFVEIP ENRV P+ PSPV+V Sbjct: 644 IDKIVEVLLETETMSGDEFRALLSEFVEIPAENRVPPSTPSPVAV 688 >gb|AAD17230.1| FtsH-like protein Pftf precursor [Nicotiana tabacum] Length = 693 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +1 Query: 1 MDKIVEVLLEKETMSGDEFRAILSEFVEIPVENRVLPAAPSPVSV 135 +DKIVEVLLEKETM+GDEFRAILSEFVEIP ENRV P P+P +V Sbjct: 649 IDKIVEVLLEKETMTGDEFRAILSEFVEIPAENRVAPVVPTPATV 693 >dbj|BAE71245.1| putative zinc dependent protease [Trifolium pratense] Length = 702 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 1 MDKIVEVLLEKETMSGDEFRAILSEFVEIPVENRVLPAAPSPVSV 135 +DKIVEVLLEKET+SGDEFRA+LSEF EIPVENRV PA P PV V Sbjct: 658 IDKIVEVLLEKETLSGDEFRALLSEFTEIPVENRVPPATPLPVPV 702 >ref|XP_003531102.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like [Glycine max] Length = 696 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +1 Query: 1 MDKIVEVLLEKETMSGDEFRAILSEFVEIPVENRVLPAAPSPVSV 135 +DKIVEVLLEKET+SGDEFRAILSEFVEIP ENRV P+ P P +V Sbjct: 652 IDKIVEVLLEKETLSGDEFRAILSEFVEIPAENRVAPSTPVPATV 696