BLASTX nr result
ID: Atractylodes22_contig00027646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00027646 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599189.1| hypothetical protein MTR_3g029970 [Medicago ... 70 2e-10 ref|XP_003599331.1| hypothetical protein MTR_3g031730 [Medicago ... 69 5e-10 emb|CBI27585.3| unnamed protein product [Vitis vinifera] 62 4e-08 >ref|XP_003599189.1| hypothetical protein MTR_3g029970 [Medicago truncatula] gi|355488237|gb|AES69440.1| hypothetical protein MTR_3g029970 [Medicago truncatula] Length = 61 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +3 Query: 153 RLIGVTRTQLPTATNYDVGSTTWADLRRAPLPSAMEVANLGH 278 RL G RTQ PTATNYDVGSTTW DLR+APL SAMEV LGH Sbjct: 17 RLEGAARTQAPTATNYDVGSTTWVDLRKAPLQSAMEVTFLGH 58 >ref|XP_003599331.1| hypothetical protein MTR_3g031730 [Medicago truncatula] gi|355488379|gb|AES69582.1| hypothetical protein MTR_3g031730 [Medicago truncatula] Length = 65 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 138 CYCSQRLIGVTRTQLPTATNYDVGSTTWADLRRAPLPSAMEVANLGH 278 C+ + + G RTQ PTATNYDVGSTTW DLR APL SAMEV LGH Sbjct: 16 CFRANEIEGAARTQAPTATNYDVGSTTWVDLRLAPLLSAMEVTCLGH 62 >emb|CBI27585.3| unnamed protein product [Vitis vinifera] Length = 105 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = +3 Query: 123 VTISMCYCSQRLIG--VTRTQLPTATNYDVGSTTWADLRRAPLPSAMEVANLGH 278 + I+M + LIG V RT+ P+ TNYDV S TWADLR PLPSAMEV LGH Sbjct: 24 IIINMKRLNHHLIGAEVARTRTPSTTNYDVDSATWADLRAVPLPSAMEVTVLGH 77