BLASTX nr result
ID: Atractylodes22_contig00027582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00027582 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528740.1| iron-sulfur cluster assembly protein, putati... 94 9e-18 gb|AFK46278.1| unknown [Medicago truncatula] 94 1e-17 ref|XP_002521181.1| iron-sulfur cluster assembly protein, putati... 94 1e-17 ref|XP_002315435.1| predicted protein [Populus trichocarpa] gi|2... 94 1e-17 ref|XP_002282752.1| PREDICTED: iron-sulfur assembly protein IscA... 94 1e-17 >ref|XP_002528740.1| iron-sulfur cluster assembly protein, putative [Ricinus communis] gi|223531834|gb|EEF33652.1| iron-sulfur cluster assembly protein, putative [Ricinus communis] Length = 138 Score = 94.4 bits (233), Expect = 9e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 130 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT Sbjct: 83 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 125 >gb|AFK46278.1| unknown [Medicago truncatula] Length = 137 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +2 Query: 2 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 130 DPKALMHV+GTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT Sbjct: 83 DPKALMHVVGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 125 >ref|XP_002521181.1| iron-sulfur cluster assembly protein, putative [Ricinus communis] gi|223539628|gb|EEF41212.1| iron-sulfur cluster assembly protein, putative [Ricinus communis] Length = 132 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +2 Query: 2 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 130 DPKALMHVIGTKMDFVDDKLRSEF+FINPNSKGQCGCGESFMT Sbjct: 77 DPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGESFMT 119 >ref|XP_002315435.1| predicted protein [Populus trichocarpa] gi|222864475|gb|EEF01606.1| predicted protein [Populus trichocarpa] Length = 141 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +2 Query: 2 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 130 DPKALMHVIGTKMDFVDDKLRSEF+FINPNSKGQCGCGESFMT Sbjct: 87 DPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGESFMT 129 >ref|XP_002282752.1| PREDICTED: iron-sulfur assembly protein IscA-like 1, mitochondrial [Vitis vinifera] gi|297740107|emb|CBI30289.3| unnamed protein product [Vitis vinifera] Length = 133 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +2 Query: 2 DPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMT 130 DPKALMHVIGTKMDFVDDKLRSEF+FINPNSKGQCGCGESFMT Sbjct: 83 DPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGESFMT 125