BLASTX nr result
ID: Atractylodes22_contig00026818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026818 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511894.1| zinc finger protein, putative [Ricinus commu... 56 3e-06 ref|NP_191705.1| brassinosteroid-responsive RING-H2 [Arabidopsis... 56 3e-06 ref|XP_002279473.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B... 55 6e-06 ref|XP_002509838.1| zinc finger protein, putative [Ricinus commu... 55 8e-06 ref|XP_002302597.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002511894.1| zinc finger protein, putative [Ricinus communis] gi|223549074|gb|EEF50563.1| zinc finger protein, putative [Ricinus communis] Length = 171 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -1 Query: 112 MGFPVGYTELFLPKLLIQVLTFLGLIRNVISVIFRFV 2 MGFPVGYTE+FLPKL + L+FLG IRN+I F F+ Sbjct: 1 MGFPVGYTEVFLPKLFVHTLSFLGFIRNIILCFFNFL 37 >ref|NP_191705.1| brassinosteroid-responsive RING-H2 [Arabidopsis thaliana] gi|297820998|ref|XP_002878382.1| brassinosteroid-responsive ring-H2 [Arabidopsis lyrata subsp. lyrata] gi|4689366|gb|AAD27870.1|AF134155_1 BRH1 RING finger protein [Arabidopsis thaliana] gi|6850837|emb|CAB71076.1| RING finger protein [Arabidopsis thaliana] gi|17644157|gb|AAL38776.1| putative RING finger protein [Arabidopsis thaliana] gi|21436189|gb|AAM51382.1| putative RING finger protein [Arabidopsis thaliana] gi|21554590|gb|AAM63625.1| RING finger protein [Arabidopsis thaliana] gi|297324220|gb|EFH54641.1| brassinosteroid-responsive ring-H2 [Arabidopsis lyrata subsp. lyrata] gi|332646687|gb|AEE80208.1| brassinosteroid-responsive RING-H2 [Arabidopsis thaliana] Length = 170 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 112 MGFPVGYTELFLPKLLIQVLTFLGLIRNVISVIFRFV 2 MGFPVGYTE+FLPKL +Q L+ LG IR ++ IFRF+ Sbjct: 1 MGFPVGYTEVFLPKLFVQTLSILGFIRTIVFSIFRFL 37 >ref|XP_002279473.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Vitis vinifera] Length = 168 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 112 MGFPVGYTELFLPKLLIQVLTFLGLIRNVISVIFRFV 2 MGFPVGYTEL LPKLL+ L+ LG IR +IS FRF+ Sbjct: 1 MGFPVGYTELLLPKLLLHTLSLLGFIRKLISYFFRFL 37 >ref|XP_002509838.1| zinc finger protein, putative [Ricinus communis] gi|223549737|gb|EEF51225.1| zinc finger protein, putative [Ricinus communis] Length = 164 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 112 MGFPVGYTELFLPKLLIQVLTFLGLIRNVISVIFRFV 2 MGFPVGYTEL LPKLLI L+ LG IR +I+ +FR++ Sbjct: 1 MGFPVGYTELLLPKLLIHTLSILGFIRKLINTLFRYL 37 >ref|XP_002302597.1| predicted protein [Populus trichocarpa] gi|222844323|gb|EEE81870.1| predicted protein [Populus trichocarpa] Length = 165 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -1 Query: 112 MGFPVGYTELFLPKLLIQVLTFLGLIRNVISVIFRFV 2 MGFPVGY+E+FLPKL + +L+FLG IRN+I +F ++ Sbjct: 1 MGFPVGYSEVFLPKLFVHILSFLGFIRNLILCLFNYL 37