BLASTX nr result
ID: Atractylodes22_contig00026761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026761 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation... 71 8e-11 ref|XP_002532670.1| eukaryotic translation initiation factor 3 s... 69 4e-10 gb|AFK36338.1| unknown [Medicago truncatula] 68 7e-10 gb|ACJ84968.1| unknown [Medicago truncatula] 68 7e-10 gb|AEI72270.1| eukaryotic translation initiation factor protein ... 68 9e-10 >ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Glycine max] Length = 437 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 377 PNHPNVYEQLIDHTKGLSGRTYKLVSQLLENAQAQAA 267 PNHPNVYEQLIDHTK L+GRTYKLVSQLLE+AQAQ A Sbjct: 400 PNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQAQTA 436 >ref|XP_002532670.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223527603|gb|EEF29717.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 323 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 377 PNHPNVYEQLIDHTKGLSGRTYKLVSQLLENAQAQAA 267 PNHPNVYEQLIDHTKGLSGRT KLV+QLLE++Q QAA Sbjct: 286 PNHPNVYEQLIDHTKGLSGRTNKLVNQLLEHSQTQAA 322 >gb|AFK36338.1| unknown [Medicago truncatula] Length = 132 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 377 PNHPNVYEQLIDHTKGLSGRTYKLVSQLLENAQAQAA 267 PN PNVYEQLIDHTK L+GRTYKLV+QLLE AQAQAA Sbjct: 95 PNRPNVYEQLIDHTKALNGRTYKLVTQLLEQAQAQAA 131 >gb|ACJ84968.1| unknown [Medicago truncatula] Length = 132 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 377 PNHPNVYEQLIDHTKGLSGRTYKLVSQLLENAQAQAA 267 PN PNVYEQLIDHTK L+GRTYKLV+QLLE AQAQAA Sbjct: 95 PNRPNVYEQLIDHTKALNGRTYKLVTQLLEQAQAQAA 131 >gb|AEI72270.1| eukaryotic translation initiation factor protein [Citrus trifoliata] Length = 439 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 377 PNHPNVYEQLIDHTKGLSGRTYKLVSQLLENAQAQAA 267 P PNVYEQLIDHTKGLSGRTYKLV QLLE+AQ QAA Sbjct: 402 PTQPNVYEQLIDHTKGLSGRTYKLVGQLLEHAQTQAA 438