BLASTX nr result
ID: Atractylodes22_contig00026619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026619 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540235.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 ref|XP_003541975.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_002312906.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002529057.1| multidrug resistance pump, putative [Ricinus... 55 6e-06 ref|XP_004156000.1| PREDICTED: proteinaceous RNase P 3-like [Cuc... 55 8e-06 >ref|XP_003540235.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Glycine max] Length = 530 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = +1 Query: 58 PKLRTFSPALYCFVDQMSENEAYMVEQEILNRGLSLEEPEIAALLGVSAK 207 P+LRT+ PAL+CF + + ++AY VE+ + G+SLEE E+AALL VSA+ Sbjct: 130 PRLRTYDPALFCFCEMLDADKAYEVEEHMSGVGVSLEEAEVAALLKVSAR 179 >ref|XP_003541975.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Glycine max] Length = 550 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = +1 Query: 58 PKLRTFSPALYCFVDQMSENEAYMVEQEILNRGLSLEEPEIAALLGVSAK 207 P+LRT+ PAL+CF + + ++AY VE+ + G+SLEE E+AALL VSA+ Sbjct: 129 PRLRTYDPALFCFCEMLDADKAYEVEEHMNGVGVSLEEAELAALLKVSAR 178 >ref|XP_002312906.1| predicted protein [Populus trichocarpa] gi|222849314|gb|EEE86861.1| predicted protein [Populus trichocarpa] Length = 482 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = +1 Query: 52 EKPKLRTFSPALYCFVDQMSENEAYMVEQEILNRGLSLEEPEIAALLGVSAK 207 E P+LRT+ PAL+CF +++ ++AY VE+ + + G+ LEE EIAALL VS + Sbjct: 123 ELPRLRTYDPALFCFCEKLEAHKAYEVEEHMGSMGVGLEEGEIAALLKVSVE 174 >ref|XP_002529057.1| multidrug resistance pump, putative [Ricinus communis] gi|223531469|gb|EEF33301.1| multidrug resistance pump, putative [Ricinus communis] Length = 561 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +1 Query: 58 PKLRTFSPALYCFVDQMSENEAYMVEQEILNRGLSLEEPEIAALLGVSAK 207 P+LRT+ P L+CF +++ +AY VE I++ G++LEE EIAALL VS + Sbjct: 135 PRLRTYDPVLFCFCEKLEAFKAYEVEDHIVSMGMNLEELEIAALLKVSVE 184 >ref|XP_004156000.1| PREDICTED: proteinaceous RNase P 3-like [Cucumis sativus] Length = 538 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/49 (48%), Positives = 37/49 (75%) Frame = +1 Query: 58 PKLRTFSPALYCFVDQMSENEAYMVEQEILNRGLSLEEPEIAALLGVSA 204 P+LRT+ PAL CF + + ++AY VEQ + + G+ LEEP+I+ALL +S+ Sbjct: 130 PRLRTYDPALICFCENLEVDKAYEVEQHMNSAGVELEEPQISALLKLSS 178