BLASTX nr result
ID: Atractylodes22_contig00026438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026438 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528706.1| Thioredoxin H-type, putative [Ricinus commun... 86 2e-15 ref|XP_003552324.1| PREDICTED: thioredoxin H9-like [Glycine max] 86 3e-15 ref|XP_004142678.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 85 5e-15 gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana t... 85 5e-15 ref|XP_003609099.1| Thioredoxin H-type 9 [Medicago truncatula] g... 85 5e-15 >ref|XP_002528706.1| Thioredoxin H-type, putative [Ricinus communis] gi|223531878|gb|EEF33695.1| Thioredoxin H-type, putative [Ricinus communis] Length = 132 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -3 Query: 336 DVDELTDFSTQWDIKATPTFFFLRDGEQFDKLVGANKTELQQKISSIVDT 187 DVDEL DFS+ WDIKATPTFFFLRDG+Q DKLVGANK ELQ+KI +++DT Sbjct: 77 DVDELADFSSSWDIKATPTFFFLRDGQQLDKLVGANKPELQKKIIAVLDT 126 >ref|XP_003552324.1| PREDICTED: thioredoxin H9-like [Glycine max] Length = 139 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 336 DVDELTDFSTQWDIKATPTFFFLRDGEQFDKLVGANKTELQQKISSIVDT 187 DVDELTDFST WDIKATPTFFFL+DG+Q DKLVGANK ELQ+KI +I D+ Sbjct: 84 DVDELTDFSTSWDIKATPTFFFLKDGQQLDKLVGANKPELQKKIVAINDS 133 >ref|XP_004142678.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] gi|449532517|ref|XP_004173227.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin H-type-like [Cucumis sativus] Length = 139 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/50 (74%), Positives = 46/50 (92%) Frame = -3 Query: 336 DVDELTDFSTQWDIKATPTFFFLRDGEQFDKLVGANKTELQQKISSIVDT 187 DVDELTDFST WDIKATPTFFFL++G+Q DKLVGANK EL++KI+++ D+ Sbjct: 84 DVDELTDFSTSWDIKATPTFFFLKEGQQIDKLVGANKIELEKKITAVADS 133 >gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana tabacum] Length = 152 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -3 Query: 336 DVDELTDFSTQWDIKATPTFFFLRDGEQFDKLVGANKTELQQKISSIVDTE 184 DVDELT+FS+ WDIKATPTFFFL+D +Q DKLVGANK ELQ+KI++I DT+ Sbjct: 94 DVDELTEFSSSWDIKATPTFFFLKDSQQIDKLVGANKPELQKKITAIADTQ 144 >ref|XP_003609099.1| Thioredoxin H-type 9 [Medicago truncatula] gi|269315892|gb|ACZ37072.1| thioredoxin h8 [Medicago truncatula] gi|355510154|gb|AES91296.1| Thioredoxin H-type 9 [Medicago truncatula] gi|388521679|gb|AFK48901.1| unknown [Medicago truncatula] Length = 139 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 336 DVDELTDFSTQWDIKATPTFFFLRDGEQFDKLVGANKTELQQKISSIVDT 187 DVDELTDFST WDIKATPTFFFL+DG+Q DKLVGANK EL++K+ +I D+ Sbjct: 84 DVDELTDFSTSWDIKATPTFFFLKDGQQLDKLVGANKPELEKKLVAIADS 133