BLASTX nr result
ID: Atractylodes22_contig00026199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026199 (668 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594054.1| Somatic embryogenesis receptor kinase [Medic... 60 3e-07 >ref|XP_003594054.1| Somatic embryogenesis receptor kinase [Medicago truncatula] gi|355483102|gb|AES64305.1| Somatic embryogenesis receptor kinase [Medicago truncatula] Length = 442 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 2/89 (2%) Frame = +3 Query: 375 DPKTNPKQWSGFLQKIKKAPSASLHTFNPGXXXXXXXXXXXXXXXXXXMQSM--PEMSSH 548 D + +QW GF + IKK P HTF+P + S+ P + S Sbjct: 36 DSEGGTRQWRGFFKLIKKGPQMPFHTFHPLKNVPKLTRRKSKRIREEFIPSLNSPALQSS 95 Query: 549 LDAELYCFVASWTNYSLTELKDATNNFSR 635 D+E CF +SW N++L E++ ATN+FS+ Sbjct: 96 FDSEFMCFKSSWKNFTLAEIQAATNDFSQ 124