BLASTX nr result
ID: Atractylodes22_contig00026151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026151 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638036.1| Cysteine-rich receptor-like protein kinase [... 60 2e-07 gb|ABD32615.1| RNA-directed DNA polymerase , putative [Medicago ... 59 4e-07 emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulga... 59 4e-07 gb|ABN08243.1| RNA-directed DNA polymerase , putative [Medicago ... 59 5e-07 gb|ABN05701.1| non-LTR retroelement reverse transcriptase-like, ... 57 2e-06 >ref|XP_003638036.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503971|gb|AES85174.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 1694 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 458 SILVNGSPTS*LNLQRGLRQGNPLSPFLFLLAVEGLQL 345 S+LVNGSPT +L+RGLRQG PLSPFLFLLA EGL + Sbjct: 474 SVLVNGSPTEEFSLERGLRQGGPLSPFLFLLAAEGLNV 511 >gb|ABD32615.1| RNA-directed DNA polymerase , putative [Medicago truncatula] Length = 422 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = -3 Query: 455 ILVNGSPTS*LNLQRGLRQGNPLSPFLFLLAVEGLQLCWRQWRSS--CLGVSQW 300 +LVNGSPT +L RGLRQG+PLSPFLFLLA EGL + + LG W Sbjct: 228 VLVNGSPTDKFSLMRGLRQGDPLSPFLFLLAAEGLNVAMKSLVDDTWLLGTKSW 281 >emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1383 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 458 SILVNGSPTS*LNLQRGLRQGNPLSPFLFLLAVEGLQLCWRQ 333 SIL+NGSPT + LQRGLRQG+PLSPFLF LAVE L L ++ Sbjct: 613 SILINGSPTQPIKLQRGLRQGDPLSPFLFNLAVEPLNLLMKK 654 >gb|ABN08243.1| RNA-directed DNA polymerase , putative [Medicago truncatula] Length = 125 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 458 SILVNGSPTS*LNLQRGLRQGNPLSPFLFLLAVEGLQL 345 S+L+NGSPT LQRGLRQ +PLSPFLFLLAVEGL + Sbjct: 52 SVLINGSPTDEFQLQRGLRQVDPLSPFLFLLAVEGLHV 89 >gb|ABN05701.1| non-LTR retroelement reverse transcriptase-like, related [Medicago truncatula] Length = 449 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 458 SILVNGSPTS*LNLQRGLRQGNPLSPFLFLLAVEGL 351 S+LVNGSPT +N+ RGL+QG+PL+PFLFLL EGL Sbjct: 97 SVLVNGSPTEEINIHRGLKQGDPLAPFLFLLVAEGL 132