BLASTX nr result
ID: Atractylodes22_contig00026143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026143 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138931.1| PREDICTED: uncharacterized protein LOC101207... 64 2e-08 ref|XP_003632314.1| PREDICTED: uncharacterized protein LOC100852... 59 4e-07 ref|XP_002530268.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_004138931.1| PREDICTED: uncharacterized protein LOC101207229 [Cucumis sativus] gi|449527448|ref|XP_004170723.1| PREDICTED: uncharacterized LOC101207229 [Cucumis sativus] Length = 90 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 LAAEERSVHNIKDLMDIAEYSLSLLRKGEIPKYIQ 107 LA+EERS+HNI+DL+D AEYSLSLLRKGEIPKYIQ Sbjct: 56 LASEERSLHNIEDLIDTAEYSLSLLRKGEIPKYIQ 90 >ref|XP_003632314.1| PREDICTED: uncharacterized protein LOC100852488 [Vitis vinifera] gi|296085220|emb|CBI28715.3| unnamed protein product [Vitis vinifera] Length = 90 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 LAAEERSVHNIKDLMDIAEYSLSLLRKGEIPKYIQ 107 LAAEERS+HNI DL+D A YSLSLLR G+IPKYIQ Sbjct: 56 LAAEERSLHNIADLIDTAHYSLSLLRNGQIPKYIQ 90 >ref|XP_002530268.1| conserved hypothetical protein [Ricinus communis] gi|223530200|gb|EEF32108.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 3 LAAEERSVHNIKDLMDIAEYSLSLLRKGEIPKYIQ 107 +A+EERS+HNI DL+D AEY+LSLLRKGEIPK+IQ Sbjct: 56 VASEERSLHNIDDLIDTAEYALSLLRKGEIPKHIQ 90