BLASTX nr result
ID: Atractylodes22_contig00026132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026132 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331162.1| predicted protein [Populus trichocarpa] gi|2... 101 7e-20 ref|XP_003568050.1| PREDICTED: uncharacterized protein LOC100842... 100 2e-19 ref|XP_003630785.1| Cov1 [Medicago truncatula] gi|355524807|gb|A... 100 2e-19 ref|XP_002441424.1| hypothetical protein SORBIDRAFT_09g026360 [S... 100 2e-19 ref|XP_002324995.1| predicted protein [Populus trichocarpa] gi|2... 100 2e-19 >ref|XP_002331162.1| predicted protein [Populus trichocarpa] gi|222873245|gb|EEF10376.1| predicted protein [Populus trichocarpa] Length = 254 Score = 101 bits (251), Expect = 7e-20 Identities = 48/55 (87%), Positives = 54/55 (98%) Frame = +1 Query: 7 VYVPTNHLYIGDVFLVNSKDIIRPNLSVREGIEIVVSGGMSMPQMLTTLDSGINV 171 VYVPTNHLYIGD+FLVN+KD+IRPNLSVREGIEIVVSGGMSMPQ+L+TLDS I+V Sbjct: 192 VYVPTNHLYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDSRISV 246 >ref|XP_003568050.1| PREDICTED: uncharacterized protein LOC100842745 [Brachypodium distachyon] Length = 277 Score = 100 bits (248), Expect = 2e-19 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = +1 Query: 1 YSVYVPTNHLYIGDVFLVNSKDIIRPNLSVREGIEIVVSGGMSMPQMLTTLD 156 Y VYVPTNHLYIGD+F+VNSKD+IRPNLSVREGIEIVVSGGMSMPQ+L+TLD Sbjct: 212 YCVYVPTNHLYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQLLSTLD 263 >ref|XP_003630785.1| Cov1 [Medicago truncatula] gi|355524807|gb|AET05261.1| Cov1 [Medicago truncatula] Length = 202 Score = 99.8 bits (247), Expect = 2e-19 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +1 Query: 7 VYVPTNHLYIGDVFLVNSKDIIRPNLSVREGIEIVVSGGMSMPQMLTTLDSGINV 171 VYVPTNHLYIGD+FLVN+KD+IRPNLSVREGIEIVVSGGMSMPQ+L+TLDS + V Sbjct: 140 VYVPTNHLYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDSHVPV 194 >ref|XP_002441424.1| hypothetical protein SORBIDRAFT_09g026360 [Sorghum bicolor] gi|241946709|gb|EES19854.1| hypothetical protein SORBIDRAFT_09g026360 [Sorghum bicolor] Length = 273 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = +1 Query: 1 YSVYVPTNHLYIGDVFLVNSKDIIRPNLSVREGIEIVVSGGMSMPQMLTTLD 156 Y VYVPTNHLYIGD+F+VNSKD+IRPNLSVREGIEIVVSGGMSMPQ+L+TLD Sbjct: 208 YCVYVPTNHLYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 259 >ref|XP_002324995.1| predicted protein [Populus trichocarpa] gi|222866429|gb|EEF03560.1| predicted protein [Populus trichocarpa] Length = 264 Score = 99.8 bits (247), Expect = 2e-19 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +1 Query: 7 VYVPTNHLYIGDVFLVNSKDIIRPNLSVREGIEIVVSGGMSMPQMLTTLDSGINV 171 VYVPTNHLYIGD+FLV +KD+IRPNLSVREGIEIVVSGGMSMPQ+L+TLDS I+V Sbjct: 207 VYVPTNHLYIGDIFLVTTKDVIRPNLSVREGIEIVVSGGMSMPQVLSTLDSSISV 261