BLASTX nr result
ID: Atractylodes22_contig00026062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00026062 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514354.1| conserved hypothetical protein [Ricinus comm... 58 1e-13 >ref|XP_002514354.1| conserved hypothetical protein [Ricinus communis] gi|223546810|gb|EEF48308.1| conserved hypothetical protein [Ricinus communis] Length = 117 Score = 58.2 bits (139), Expect(2) = 1e-13 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 35 MEIRVFVPPDRPDHYRMIIRVKPGEVKKVLTKSY 136 MEIRVFVPPDRPD +R IIR+KPGE K++L KS+ Sbjct: 1 MEIRVFVPPDRPDRFRKIIRIKPGENKEILVKSF 34 Score = 42.7 bits (99), Expect(2) = 1e-13 Identities = 22/73 (30%), Positives = 41/73 (56%) Frame = +1 Query: 112 QESVDQKLCDWEEYFPSETDKHIFLMVFMDGIYTGVTLLPWEVKKYTKIIGYYVGDCGVV 291 +E + + CDW+ ++ + M+F++G+YTGV+L+P + Y ++I D V Sbjct: 27 KEILVKSFCDWD----INPERPVMFMLFVEGVYTGVSLMPTYLIGYKRVICDRSEDGLVH 82 Query: 292 LQGVRFTFASFFR 330 L+G+R + F R Sbjct: 83 LRGIRASILDFCR 95