BLASTX nr result
ID: Atractylodes22_contig00025947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025947 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301500.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 gb|ABK93302.1| unknown [Populus trichocarpa] 65 6e-09 ref|XP_002275125.1| PREDICTED: uncharacterized protein LOC100257... 65 6e-09 emb|CAN74686.1| hypothetical protein VITISV_020416 [Vitis vinifera] 65 6e-09 ref|XP_002515310.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_002301500.1| predicted protein [Populus trichocarpa] gi|222843226|gb|EEE80773.1| predicted protein [Populus trichocarpa] Length = 212 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 95 GKRSRDPEDEVYVDNLHSHKRYLSEIMASSL 3 GKRSRDPEDEVY+DNLHSHKRYLSEIMASSL Sbjct: 5 GKRSRDPEDEVYLDNLHSHKRYLSEIMASSL 35 >gb|ABK93302.1| unknown [Populus trichocarpa] Length = 271 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 95 GKRSRDPEDEVYVDNLHSHKRYLSEIMASSL 3 GKRSRDPEDEVY+DNLHSHKRYLSEIMASSL Sbjct: 29 GKRSRDPEDEVYLDNLHSHKRYLSEIMASSL 59 >ref|XP_002275125.1| PREDICTED: uncharacterized protein LOC100257226 [Vitis vinifera] gi|297743955|emb|CBI36925.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 95 GKRSRDPEDEVYVDNLHSHKRYLSEIMASSL 3 GKRSRDPEDEVY+DNLHSHKRYLSEIMASSL Sbjct: 18 GKRSRDPEDEVYLDNLHSHKRYLSEIMASSL 48 >emb|CAN74686.1| hypothetical protein VITISV_020416 [Vitis vinifera] Length = 251 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 95 GKRSRDPEDEVYVDNLHSHKRYLSEIMASSL 3 GKRSRDPEDEVY+DNLHSHKRYLSEIMASSL Sbjct: 18 GKRSRDPEDEVYLDNLHSHKRYLSEIMASSL 48 >ref|XP_002515310.1| conserved hypothetical protein [Ricinus communis] gi|223545790|gb|EEF47294.1| conserved hypothetical protein [Ricinus communis] Length = 269 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 95 GKRSRDPEDEVYVDNLHSHKRYLSEIMASSL 3 GKR+RDPEDEVY+DNLHSHKRYLSEIMASSL Sbjct: 23 GKRNRDPEDEVYLDNLHSHKRYLSEIMASSL 53