BLASTX nr result
ID: Atractylodes22_contig00025937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025937 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812... 61 8e-08 ref|XP_003636545.1| Pentatricopeptide repeat-containing protein ... 61 1e-07 gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula]... 59 4e-07 ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808... 56 3e-06 >ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812827 [Glycine max] Length = 572 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/58 (46%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -2 Query: 183 LPEFSGYDPKGWIAKAELYFNIHGTPH-FRIHLAQLSMSGVAQHWFTIVKETHPDLTW 13 LP F G DP WI +AE+YF++ T R+ LA+LSM G HWF ++ ET +L+W Sbjct: 76 LPLFDGDDPVAWITRAEIYFDVQDTSDDMRVKLARLSMEGSTIHWFNLLMETEDELSW 133 >ref|XP_003636545.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502480|gb|AES83683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1280 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -2 Query: 183 LPEFSGYDPKGWIAKAELYFNIHGTP-HFRIHLAQLSMSGVAQHWFTIVKETHPDLT 16 LP F G DP WI +AE+YF++ TP R+ L++LSM G HWF ++ ET DL+ Sbjct: 749 LPLFEGDDPVAWITRAEIYFDVQNTPDDMRVKLSRLSMEGPTIHWFNLLMETEDDLS 805 >gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula] gi|124360393|gb|ABN08406.1| Retrotransposon gag protein [Medicago truncatula] Length = 224 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -2 Query: 174 FSGYDPKGWIAKAELYFNIHG-TPHFRIHLAQLSMSGVAQHWFTIVKETHPDLTW 13 F+G DP GWIA+AE+YFN+ TP +++LAQL M G H+F + E + LTW Sbjct: 89 FNGDDPAGWIARAEVYFNVQNTTPEIKVNLAQLCMDGPTIHFFKGLLEENETLTW 143 >ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808652 [Glycine max] Length = 463 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -2 Query: 183 LPEFSGYDPKGWIAKAELYFNIHGTPH-FRIHLAQLSMSGVAQHWFTIVKETHPDLTW 13 LP F G D WI + E+YF++ T R+ LA+LSM G HWF ++ ET +L+W Sbjct: 59 LPLFEGDDLVAWITRVEIYFDVQNTTDKMRVKLARLSMEGSTIHWFNLLMETEDELSW 116