BLASTX nr result
ID: Atractylodes22_contig00025826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025826 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322790.1| predicted protein [Populus trichocarpa] gi|2... 104 7e-21 ref|XP_002532543.1| protein binding protein, putative [Ricinus c... 102 2e-20 ref|XP_002309247.1| predicted protein [Populus trichocarpa] gi|2... 102 2e-20 ref|XP_003543669.1| PREDICTED: exocyst complex component 7-like ... 102 4e-20 ref|XP_003543668.1| PREDICTED: exocyst complex component 7-like ... 102 4e-20 >ref|XP_002322790.1| predicted protein [Populus trichocarpa] gi|222867420|gb|EEF04551.1| predicted protein [Populus trichocarpa] Length = 644 Score = 104 bits (260), Expect = 7e-21 Identities = 50/61 (81%), Positives = 59/61 (96%) Frame = -3 Query: 185 AEAKILRGPHEDLESYLEAIEQLRSNIVFFTNNKSFKSSDGVISHASNLLSKAISKLEQE 6 AEAKILRGPHEDLESYLEAI+QLRSN+ FF++NKSFKSSDGV++HA+ LL+KAISKLE+E Sbjct: 86 AEAKILRGPHEDLESYLEAIDQLRSNVKFFSSNKSFKSSDGVLNHANQLLAKAISKLEEE 145 Query: 5 F 3 F Sbjct: 146 F 146 >ref|XP_002532543.1| protein binding protein, putative [Ricinus communis] gi|223527732|gb|EEF29837.1| protein binding protein, putative [Ricinus communis] Length = 638 Score = 102 bits (255), Expect = 2e-20 Identities = 49/61 (80%), Positives = 58/61 (95%) Frame = -3 Query: 185 AEAKILRGPHEDLESYLEAIEQLRSNIVFFTNNKSFKSSDGVISHASNLLSKAISKLEQE 6 AEAKILRGPHEDLESYLEAI+QLRSN+ FF++NK+FKSSDGV++HA+ LL+KAISKLE E Sbjct: 86 AEAKILRGPHEDLESYLEAIDQLRSNVKFFSSNKNFKSSDGVLNHANQLLAKAISKLEDE 145 Query: 5 F 3 F Sbjct: 146 F 146 >ref|XP_002309247.1| predicted protein [Populus trichocarpa] gi|222855223|gb|EEE92770.1| predicted protein [Populus trichocarpa] Length = 644 Score = 102 bits (255), Expect = 2e-20 Identities = 49/61 (80%), Positives = 58/61 (95%) Frame = -3 Query: 185 AEAKILRGPHEDLESYLEAIEQLRSNIVFFTNNKSFKSSDGVISHASNLLSKAISKLEQE 6 AEAKILRGPHEDLESYLEAI+QLRSN+ FF++NKSFK SDGV++HA+ LL+KAISKLE+E Sbjct: 86 AEAKILRGPHEDLESYLEAIDQLRSNVKFFSSNKSFKCSDGVLNHANQLLAKAISKLEEE 145 Query: 5 F 3 F Sbjct: 146 F 146 >ref|XP_003543669.1| PREDICTED: exocyst complex component 7-like isoform 2 [Glycine max] Length = 627 Score = 102 bits (253), Expect = 4e-20 Identities = 47/61 (77%), Positives = 60/61 (98%) Frame = -3 Query: 185 AEAKILRGPHEDLESYLEAIEQLRSNIVFFTNNKSFKSSDGVISHASNLLSKAISKLEQE 6 AEAKILRGPHEDLESYLEAI+QLR+N+ FF++NKSFKSS+G+I+HA+NLL+KA++KLE+E Sbjct: 86 AEAKILRGPHEDLESYLEAIDQLRANVRFFSSNKSFKSSEGIINHANNLLAKAMTKLEEE 145 Query: 5 F 3 F Sbjct: 146 F 146 >ref|XP_003543668.1| PREDICTED: exocyst complex component 7-like isoform 1 [Glycine max] Length = 628 Score = 102 bits (253), Expect = 4e-20 Identities = 47/61 (77%), Positives = 60/61 (98%) Frame = -3 Query: 185 AEAKILRGPHEDLESYLEAIEQLRSNIVFFTNNKSFKSSDGVISHASNLLSKAISKLEQE 6 AEAKILRGPHEDLESYLEAI+QLR+N+ FF++NKSFKSS+G+I+HA+NLL+KA++KLE+E Sbjct: 86 AEAKILRGPHEDLESYLEAIDQLRANVRFFSSNKSFKSSEGIINHANNLLAKAMTKLEEE 145 Query: 5 F 3 F Sbjct: 146 F 146