BLASTX nr result
ID: Atractylodes22_contig00025822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025822 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629499.1| hypothetical protein MTR_8g078200 [Medicago ... 80 2e-13 ref|XP_003518054.1| PREDICTED: uncharacterized protein LOC100787... 79 3e-13 ref|XP_003548899.1| PREDICTED: uncharacterized protein LOC100810... 79 5e-13 ref|XP_003611912.1| hypothetical protein MTR_5g019330 [Medicago ... 72 6e-11 ref|XP_002533270.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 >ref|XP_003629499.1| hypothetical protein MTR_8g078200 [Medicago truncatula] gi|355523521|gb|AET03975.1| hypothetical protein MTR_8g078200 [Medicago truncatula] Length = 313 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +2 Query: 131 TQARLIYYLSEHPEIVNFRWSHTQSWGSTWSFLFTSIFTYVFLSLFL 271 T LIYYLSEHP I++FRWSH+ SWGSTWSFL TSI TY+ LSLFL Sbjct: 12 TIGTLIYYLSEHPSIISFRWSHSHSWGSTWSFLITSIATYLILSLFL 58 >ref|XP_003518054.1| PREDICTED: uncharacterized protein LOC100787513 [Glycine max] Length = 282 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 143 LIYYLSEHPEIVNFRWSHTQSWGSTWSFLFTSIFTYVFLSLFL 271 LIYYLSEHP IV FRWSH QSWG+TWSFLFTSI +Y+FLS+ L Sbjct: 3 LIYYLSEHPAIVGFRWSHAQSWGATWSFLFTSIASYLFLSILL 45 >ref|XP_003548899.1| PREDICTED: uncharacterized protein LOC100810676 [Glycine max] Length = 291 Score = 78.6 bits (192), Expect = 5e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 143 LIYYLSEHPEIVNFRWSHTQSWGSTWSFLFTSIFTYVFLSLFL 271 +IYYLSEHP IV FRWSH QSWG+TWSFLF+SI +Y+FLS+FL Sbjct: 10 VIYYLSEHPAIVGFRWSHAQSWGATWSFLFSSIASYLFLSVFL 52 >ref|XP_003611912.1| hypothetical protein MTR_5g019330 [Medicago truncatula] gi|355513247|gb|AES94870.1| hypothetical protein MTR_5g019330 [Medicago truncatula] Length = 302 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +2 Query: 143 LIYYLSEHPEIVNFRWSHTQSWGSTWSFLFTSIFTYVFLSLFL 271 L +YLSEHP IV FRWSHTQSWGSTWSF+F SI Y+ SL L Sbjct: 11 LNFYLSEHPSIVGFRWSHTQSWGSTWSFIFMSIAIYIVTSLLL 53 >ref|XP_002533270.1| conserved hypothetical protein [Ricinus communis] gi|223526895|gb|EEF29102.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 122 STMTQARLIYYLSEHPEIVNFRWSHTQSWGSTWSFLFTSIFTYVFLSLFL 271 +TMTQ+ L Y+LS HP I+ FRWSH+QSWGSTWSFLF+SI Y+ SL + Sbjct: 6 ATMTQS-LTYHLSNHPSIITFRWSHSQSWGSTWSFLFSSITFYLSFSLIM 54