BLASTX nr result
ID: Atractylodes22_contig00025668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025668 (646 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157939.1| PREDICTED: pentatricopeptide repeat-containi... 79 7e-21 ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containi... 79 7e-21 ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containi... 78 9e-20 ref|XP_002512275.1| pentatricopeptide repeat-containing protein,... 74 2e-17 ref|XP_003527646.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-17 >ref|XP_004157939.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Cucumis sativus] Length = 548 Score = 79.0 bits (193), Expect(2) = 7e-21 Identities = 35/65 (53%), Positives = 49/65 (75%) Frame = +1 Query: 130 VVTFTSVISGYCKLGKMDAAMVLFDDIISHGIRPNTVTFNVIIDGLGKIDNMVYVLCLRR 309 V+T+TS+ISGYCKLG M AA LFD+++S GI+PN TFNV+IDG GK+ NM + + Sbjct: 285 VITYTSIISGYCKLGDMKAASELFDEMVSSGIKPNDFTFNVLIDGFGKVGNMRSAMVMYE 344 Query: 310 WLILV 324 ++L+ Sbjct: 345 KMLLL 349 Score = 47.4 bits (111), Expect(2) = 7e-21 Identities = 21/44 (47%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +3 Query: 9 GKFGCLLDSVTYNTLL-GFCSADNVDKAHELLRETCMVVGKSCD 137 G FGC D V+YNTL+ GFC + + K H+LL+E ++ G S D Sbjct: 241 GNFGCFPDIVSYNTLINGFCRVNEISKGHDLLKEDMLIKGVSPD 284 >ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Cucumis sativus] Length = 548 Score = 79.0 bits (193), Expect(2) = 7e-21 Identities = 35/65 (53%), Positives = 49/65 (75%) Frame = +1 Query: 130 VVTFTSVISGYCKLGKMDAAMVLFDDIISHGIRPNTVTFNVIIDGLGKIDNMVYVLCLRR 309 V+T+TS+ISGYCKLG M AA LFD+++S GI+PN TFNV+IDG GK+ NM + + Sbjct: 285 VITYTSIISGYCKLGDMKAASELFDEMVSSGIKPNDFTFNVLIDGFGKVGNMRSAMVMYE 344 Query: 310 WLILV 324 ++L+ Sbjct: 345 KMLLL 349 Score = 47.4 bits (111), Expect(2) = 7e-21 Identities = 21/44 (47%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +3 Query: 9 GKFGCLLDSVTYNTLL-GFCSADNVDKAHELLRETCMVVGKSCD 137 G FGC D V+YNTL+ GFC + + K H+LL+E ++ G S D Sbjct: 241 GNFGCFPDIVSYNTLINGFCRVNEISKGHDLLKEDMLIKGVSPD 284 >ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vitis vinifera] Length = 641 Score = 77.8 bits (190), Expect(3) = 9e-20 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = +1 Query: 130 VVTFTSVISGYCKLGKMDAAMVLFDDIISHGIRPNTVTFNVIIDGLGKIDNMV 288 VVT+TS+ISGYCKLGKM+ A +LF+++IS GI+PN TFN++I+G GK+ +MV Sbjct: 308 VVTYTSIISGYCKLGKMEKASILFNNMISSGIKPNAFTFNILINGFGKVGDMV 360 Score = 42.4 bits (98), Expect(3) = 9e-20 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +3 Query: 15 FGCLLDSVTYNTLL-GFCSADNVDKAHELLRE 107 FGC D +TYNTL+ GFC + VD+ H+LL+E Sbjct: 266 FGCSPDVITYNTLINGFCRVNEVDRGHDLLKE 297 Score = 22.3 bits (46), Expect(3) = 9e-20 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +3 Query: 297 MFEKMVNLGCTPNV 338 M+E+M+ LGC P++ Sbjct: 365 MYEEMLLLGCPPDI 378 >ref|XP_002512275.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548236|gb|EEF49727.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 532 Score = 73.9 bits (180), Expect(2) = 2e-17 Identities = 34/53 (64%), Positives = 44/53 (83%) Frame = +1 Query: 130 VVTFTSVISGYCKLGKMDAAMVLFDDIISHGIRPNTVTFNVIIDGLGKIDNMV 288 V+T+TS+ISG+ KLGK++AA VLF+++I GI P VTFNV+IDG GKI NMV Sbjct: 269 VMTYTSIISGFRKLGKLEAASVLFEEMIRSGIEPTVVTFNVLIDGFGKIGNMV 321 Score = 40.8 bits (94), Expect(2) = 2e-17 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +3 Query: 15 FGCLLDSVTYNTLL-GFCSADNVDKAHELLRE 107 FGCL D VTYNTL+ G C A+ +D+A +LL+E Sbjct: 227 FGCLPDVVTYNTLISGLCKANELDRACDLLKE 258 >ref|XP_003527646.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] Length = 511 Score = 70.1 bits (170), Expect(2) = 2e-17 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = +1 Query: 130 VVTFTSVISGYCKLGKMDAAMVLFDDIISHGIRPNTVTFNVIIDGLGKIDNMVYVLCL 303 VV++T +ISGYCKL KM+ +LFD++I+ G PNT TFN +IDG GK+ +M L L Sbjct: 248 VVSYTMIISGYCKLRKMEEGSLLFDEMINSGTAPNTFTFNALIDGFGKLGDMASALAL 305 Score = 44.7 bits (104), Expect(2) = 2e-17 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 15 FGCLLDSVTYNTLL-GFCSADNVDKAHELLRETCM 116 FGCL D +TYNTL+ G C + VD+A LLRE C+ Sbjct: 206 FGCLPDVITYNTLIHGLCLINEVDRARSLLREVCL 240