BLASTX nr result
ID: Atractylodes22_contig00024947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024947 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330827.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_003580502.1| PREDICTED: putative RNA methyltransferase At... 59 3e-07 ref|XP_004136320.1| PREDICTED: putative RNA methyltransferase At... 55 6e-06 ref|XP_004136319.1| PREDICTED: putative RNA methyltransferase At... 55 6e-06 tpg|DAA36114.1| TPA: hypothetical protein ZEAMMB73_824445 [Zea m... 55 8e-06 >ref|XP_002330827.1| predicted protein [Populus trichocarpa] gi|222872629|gb|EEF09760.1| predicted protein [Populus trichocarpa] Length = 189 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 224 PPHSGAKTRGSKYTGQSIKPLPIHLLTVGKTRSPGVQLIVKEYMDKL 364 PP SG + R KYTGQS++ LPI ++TVGK RS GVQL+V+EY +KL Sbjct: 15 PPPSGGEGRLCKYTGQSVRALPIRIITVGKKRSAGVQLLVEEYTNKL 61 >ref|XP_003580502.1| PREDICTED: putative RNA methyltransferase At5g10620-like [Brachypodium distachyon] Length = 203 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +2 Query: 224 PPHSGAKTRGSKYTGQSIKPLPIHLLTVGKTRSPGVQLIVKEYMDKL 364 PP A+ R SKY+GQS++ +PI +LTVGK RS G QL+V+EY +KL Sbjct: 29 PPPLAARGRRSKYSGQSVRTMPIRVLTVGKKRSQGTQLLVEEYKEKL 75 >ref|XP_004136320.1| PREDICTED: putative RNA methyltransferase At5g10620-like isoform 2 [Cucumis sativus] gi|449505515|ref|XP_004162494.1| PREDICTED: putative RNA methyltransferase At5g10620-like isoform 2 [Cucumis sativus] Length = 182 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 257 KYTGQSIKPLPIHLLTVGKTRSPGVQLIVKEYMDKL 364 KYTGQS++ +PI +LTVGK RS GVQL+V EY+DKL Sbjct: 19 KYTGQSVRAVPIRVLTVGKKRSRGVQLLVDEYIDKL 54 >ref|XP_004136319.1| PREDICTED: putative RNA methyltransferase At5g10620-like isoform 1 [Cucumis sativus] gi|449505511|ref|XP_004162493.1| PREDICTED: putative RNA methyltransferase At5g10620-like isoform 1 [Cucumis sativus] Length = 202 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 257 KYTGQSIKPLPIHLLTVGKTRSPGVQLIVKEYMDKL 364 KYTGQS++ +PI +LTVGK RS GVQL+V EY+DKL Sbjct: 19 KYTGQSVRAVPIRVLTVGKKRSRGVQLLVDEYIDKL 54 >tpg|DAA36114.1| TPA: hypothetical protein ZEAMMB73_824445 [Zea mays] Length = 203 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 248 RGSKYTGQSIKPLPIHLLTVGKTRSPGVQLIVKEYMDKL 364 R SKY+GQS+K +P+ LLTVGK RS G QL+V+EY +KL Sbjct: 31 RRSKYSGQSVKAMPMRLLTVGKKRSRGTQLLVEEYKEKL 69