BLASTX nr result
ID: Atractylodes22_contig00024744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024744 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283668.2| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_002527345.1| pentatricopeptide repeat-containing protein,... 89 4e-16 ref|XP_004168621.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 ref|XP_003518275.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 ref|XP_003544256.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-10 >ref|XP_002283668.2| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Length = 762 Score = 90.1 bits (222), Expect = 2e-16 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 14/114 (12%) Frame = -3 Query: 301 MASLPSVVIGNTIKLESEFKRRTATFPSIEKRNS----SSSYLDKGFDALSLDFRE---- 146 MASLPSV + T K ESEF++ +A+F EK S S+ LD +A LDFRE Sbjct: 1 MASLPSVAVTRTPKSESEFRKYSASFLPSEKSPSVSYQRSTQLDGVSEARCLDFREALSF 60 Query: 145 ------VESSTYVPLLQKCVEKNSFQEAQIIHGHIMKSGTLEDLFVMTSLVNVY 2 VES+ YVP+LQ+C++K +AQ IH HI+K+G +D F+MT LVNVY Sbjct: 61 IREGTKVESAFYVPILQECIDKKLVSDAQKIHAHIVKTGAHKDAFLMTFLVNVY 114 >ref|XP_002527345.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533264|gb|EEF35017.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 687 Score = 89.0 bits (219), Expect = 4e-16 Identities = 52/119 (43%), Positives = 74/119 (62%), Gaps = 19/119 (15%) Frame = -3 Query: 301 MASLPSVVIGNTIKLESEFKRRTATFPSIEKRNSSSSY--------LDKGFDALS-LDFR 149 MASLPSV + +T+KLE E ++ ++ +++ S+SY LD + + L+F Sbjct: 1 MASLPSVSLSSTLKLEPELRKHPSSSSLPTEKSPSTSYQRSSINTQLDGSLEPIKPLEFH 60 Query: 148 E----------VESSTYVPLLQKCVEKNSFQEAQIIHGHIMKSGTLEDLFVMTSLVNVY 2 E +E S Y+PLLQ+C +KNS EAQ+IH HI+K+GT +DL VMTSLVNVY Sbjct: 61 EALCFIKEEKKIEPSYYLPLLQECTKKNSVSEAQVIHAHIIKTGTHKDLAVMTSLVNVY 119 >ref|XP_004168621.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 755 Score = 82.0 bits (201), Expect = 5e-14 Identities = 49/109 (44%), Positives = 69/109 (63%), Gaps = 9/109 (8%) Frame = -3 Query: 301 MASLPSVVIGNTIKLESEFKRR--TATFPSIEKRNSSSSYLDKGFDALSLDFRE------ 146 MAS+PSV + +KLE+ ++R TA+FP +K S + L++ E Sbjct: 1 MASVPSVSLTAALKLETHPRKRHSTASFPLNDKDKSVGFQKNHSLIQLNVVDAEEPKLGT 60 Query: 145 -VESSTYVPLLQKCVEKNSFQEAQIIHGHIMKSGTLEDLFVMTSLVNVY 2 +ESS Y PLLQ+C+++N EA++IHGHI+K+G EDLFVMT LVNVY Sbjct: 61 RIESSYYFPLLQECIDRNLATEARMIHGHIVKTGFHEDLFVMTFLVNVY 109 >ref|XP_003518275.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Glycine max] Length = 754 Score = 70.5 bits (171), Expect = 1e-10 Identities = 45/110 (40%), Positives = 65/110 (59%), Gaps = 10/110 (9%) Frame = -3 Query: 301 MASLPSVVIGNTIKLESEFKRRTATFPSIEKRNSSS-------SYLDKGFDALSLD---F 152 MAS S + T+KL +F + + + EK S S ++LD G +AL L+ Sbjct: 1 MASFFSSAVTATLKLHPQFPKYSPSSYPPEKGQSISFQKSHRFTHLDFG-EALLLNKEGT 59 Query: 151 REVESSTYVPLLQKCVEKNSFQEAQIIHGHIMKSGTLEDLFVMTSLVNVY 2 E E YVPLLQ+C++K S+ QI+HGH+MK+G ++ FVM+ LVNVY Sbjct: 60 EEEEKLFYVPLLQQCLDKRSYSGTQIVHGHVMKTGCHDNFFVMSFLVNVY 109 >ref|XP_003544256.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Glycine max] Length = 758 Score = 69.3 bits (168), Expect = 3e-10 Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 14/114 (12%) Frame = -3 Query: 301 MASLPSVVIGNTIKLESEFKRRTATFPSI---EKRNSSSSYLDKGFDALSLDFREV---- 143 MAS S V+ T+KL +F + PS EK S S K LDF E Sbjct: 1 MASFLSSVVTATLKLHPQFPKYPIYPPSSYPPEKGQSIS--FQKSHRFTHLDFGETLLLT 58 Query: 142 -------ESSTYVPLLQKCVEKNSFQEAQIIHGHIMKSGTLEDLFVMTSLVNVY 2 E YVPLLQ+C++ S+ E QI+HGH+MK+G ++ FVM+ LVNVY Sbjct: 59 KEGTEEEEKLFYVPLLQQCLDTRSYSETQIVHGHVMKTGCHDNFFVMSFLVNVY 112